Recombinant Full Length Neosartorya Fumigata Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL18190NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Palmitoyltransferase swf1(swf1) Protein (Q4WN54) (1-379aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-379) |
Form : | Lyophilized powder |
AA Sequence : | MCYYISILIYWGADCRTVGTGPVLMYCTKTIRSYFRCRHPFFSSINSSQIFFLSLLIAGE CMFIPSAWPRVSTFHRLFIPALALLPYVFLYASVVTKSYITHENHEDEMARYPYDRVIFN PGHRCRTCDFLKPARSKHCSFCKACVSRHDHHCVWLTNCVGRNNYHYFLSLLLSLSLMLA YGSWLGFSLVSQTLEGLIPSSSPLRSKSQDWTTWLNVWAIAIASDIRVGAVAMLTAMTAP LAMAFLLYHTYLIWAGMTTNESAKWSDWKEDVADGLVFKSTRSEIYGNQSHSDEDTPAQR TWPVSSNQILVITDGEPPKEGFQLCSRSNEILQKDDPQAPVDTRWTEVNSMREIDNIYDL GFWDNLREVFHMPIRRCVR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | swf1 |
Synonyms | swf1; AFUA_6G07570; Palmitoyltransferase swf1 |
UniProt ID | Q4WN54 |
◆ Recombinant Proteins | ||
RFL16970SF | Recombinant Full Length Staphylococcus Aureus Uncharacterized Membrane Protein Sar0800(Sar0800) Protein, His-Tagged | +Inquiry |
ACRBP-155H | Recombinant Human ACRBP Protein, HIS-tagged | +Inquiry |
SYNPR-8918M | Recombinant Mouse SYNPR Protein, His (Fc)-Avi-tagged | +Inquiry |
HMGCR-263H | Active Recombinant Human HMGCR protein, His-tagged | +Inquiry |
HSF2-700H | Recombinant Human HSF2 Protein, His/GST-tagged | +Inquiry |
◆ Native Proteins | ||
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
HGF-232P | Native Porcine HGF | +Inquiry |
F10-9H | Native Human Factor Xa, Active Site Labeled with Biotin | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
FGB-56R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
PPP1R2P9-1402HCL | Recombinant Human PPP1R2P9 cell lysate | +Inquiry |
C20orf20-8119HCL | Recombinant Human C20orf20 293 Cell Lysate | +Inquiry |
PRAP1-001HCL | Recombinant Human PRAP1 cell lysate | +Inquiry |
CEACAM1-3039HCL | Recombinant Human CEACAM1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All swf1 Products
Required fields are marked with *
My Review for All swf1 Products
Required fields are marked with *
0
Inquiry Basket