Recombinant Full Length Emericella Nidulans Palmitoyltransferase Swf1(Swf1) Protein, His-Tagged
Cat.No. : | RFL34274EF |
Product Overview : | Recombinant Full Length Emericella nidulans Palmitoyltransferase swf1(swf1) Protein (Q5BC23) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Emericella nidulans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MGLLRTIALVILGFSAFIFTVLFGRLPVFRKTPIGLLHRIIWLHIPHGISYIDARLFNGR ILRSWGQAGNYILYENHPLVLIFFTTILVIGELIFIPSAWPRISVMHQLYIPIIIALPYY FLYVSVVTKSYITPDNHAEEMKRYPYDKVIFHPGHSCETCHFLKPARSKHCSYCKRCVSR QDHHCIWLTNCVGLNNYHYFLYLLLSLSVMLTYGSWLGYSLLSQTLDRLIPPSSPVRLRK QSWPTFLNMWAAVVAYDTRIGGVTMLMFMTAPLAFAFLVYHVYLIWAGMTTNESAKWSDW KDDITDGMAFKFIGDHKRSDSPLLESAETADSWPGYSDQILVLTEGDPPKEGHQVHKSSN DVIQPTNPDAPIDRRFARVRSMKEIDNIYDLGFWNNLCHVFGNYAAGKAHRA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | swf1 |
Synonyms | swf1; AN1907; Palmitoyltransferase swf1 |
UniProt ID | Q5BC23 |
◆ Native Proteins | ||
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
CNAN-133A | Native Arachis hypogaea seed Conarachin | +Inquiry |
MYH-11R | Active Native Rabbit Myosin II Protein | +Inquiry |
gp125-261V | Native EBV Viral Capsid gp125 Protein | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
VHL-410HCL | Recombinant Human VHL 293 Cell Lysate | +Inquiry |
SCFD1-2041HCL | Recombinant Human SCFD1 293 Cell Lysate | +Inquiry |
AASDHPPT-2HCL | Recombinant Human AASDHPPT cell lysate | +Inquiry |
FANCG-6331HCL | Recombinant Human FANCG 293 Cell Lysate | +Inquiry |
MGC35440-4336HCL | Recombinant Human MGC35440 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All swf1 Products
Required fields are marked with *
My Review for All swf1 Products
Required fields are marked with *
0
Inquiry Basket