Recombinant Full Length Schizosaccharomyces Pombe Formation Of Crista Junctions Protein C3E7.05C (Spbc3E7.05C) Protein, His-Tagged
Cat.No. : | RFL29563SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Formation of crista junctions protein C3E7.05c (SPBC3E7.05c) Protein (O59725) (39-550aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (39-550) |
Form : | Lyophilized powder |
AA Sequence : | NKTEPIPFVPKPEEGSSNKSNSSKFRKRFLLLFLLGITGYSCSVVYCFKDPNFYDYFAEH TPFGKQVLYNVEQSWIGYKYLGGNRIKVDDSSPKLKQNSNNISKKQNSSRNDDTKVKKDT TIERPESLVVEIVDLPSEVTKDTAEESVWKDIGLDQETGLSVTAIPIITETLDHAHEQEI KDQSLRFESSLNEANELHGKLSKIQQEQEHLFEQRLREKVSEMESKLEALLIARDEKWQS AFESEKLRLQKLHEARLQQELFKLASVFESKLKNELTEQAITLEKLHLQSIKAQVEQERG SRLGRLQELRNSFQQLQELVRVVLHENGRVTRLVDVSNTLDDLNKDMRFHKLSEVRQHVN TLKEATKDDELAALASRVIEKIVDSGPILDKEELQTKFDTLSKEIYKTCFLTTESGFFGH LKSIILSQLPAAVFKSPDIVSVKKTLEDARSHLLKDDLDGSVRALLSLSQWPRALSRDWI NACRRRMELQQAIEIIKASATLSSQLEDAQQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; SPBC3E7.05c; MICOS complex subunit mic60; Mitofilin |
UniProt ID | O59725 |
◆ Recombinant Proteins | ||
HA-809V | Recombinant H5N1 (A/hubei/1/2010) HA Protein, His-tagged | +Inquiry |
EZH2-65HFL | Active Recombinant Full Length Human EZH2 Protein, C-Flag-tagged | +Inquiry |
CR1L-1582R | Recombinant Rat CR1L Protein | +Inquiry |
ETV6-3540H | Recombinant Human ETV6 Protein, GST-tagged | +Inquiry |
SNAPC5-1755C | Recombinant Chicken SNAPC5 | +Inquiry |
◆ Native Proteins | ||
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
CTSL1-1859H | Native Human Cathepsin L1 | +Inquiry |
H3N20799-215I | Native H3N2 (A/Panama/2007/99) H3N20799 protein | +Inquiry |
CASQ2-30C | Native Canine CASQ2 | +Inquiry |
FN1-4399H | Native Human FN1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF13-1346MCL | Recombinant Mouse TNFSF13 cell lysate | +Inquiry |
KIAA0825-1099HCL | Recombinant Human KIAA0825 cell lysate | +Inquiry |
EFCAB4A-6708HCL | Recombinant Human EFCAB4A 293 Cell Lysate | +Inquiry |
Grape-694P | Grape Lysate, Total Protein | +Inquiry |
CLEC4M-2744HCL | Recombinant Human CLEC4M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket