Recombinant Full Length Pichia Pastoris Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL20808KF |
Product Overview : | Recombinant Full Length Pichia pastoris Formation of crista junctions protein 1(FCJ1) Protein (C4QXN2) (20-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Komagataella phaffii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-509) |
Form : | Lyophilized powder |
AA Sequence : | QSTNPTVKKSKPLRKFLFRLGLLTGVFYAGGVAVSLKNDIVQDAFIEHVPLGEALLDFTE YYVNHPEELSFSSTKQKLQNFDKTVLIPKRGVQSAKVEDVEHIKNVTRGSADESVSLSKT IYSNLNLPSIDLEFKDEVLQSSVEHLNHLIDTIRTQVNTVDLLPQVEQLKSSIKELGSKY NSFVTDRNTAVEEALAKLDDELKTKYQNKELALTDKYISDLQETKRQIELKHDQILAKEL DTAQRRILLEAENIIVQARINTLSEFESIISDKIDNERNGKLKNLDALAKRVEELENVQI KLFDNISNAEKLTNLKKTVSKINRLLISSNDGVDAKTLINEVNKFKTYSKDLNNELISSV LLNLPNDKALSNGVLSQAQLLARWDLLTPELRSASLLPPNAGILGHLSSKLFSFFLLGKS GTPTSGNDIESVISRVHDNLLKNRLDDALEEVSSLKGWSRKLSEDWIVEARKKLELQVLV GVLENEVSLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; PAS_chr1-4_0172; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C4QXN2 |
◆ Recombinant Proteins | ||
RFL12729CF | Recombinant Full Length Candida Glabrata Golgi To Er Traffic Protein 1(Get1) Protein, His-Tagged | +Inquiry |
ADARB1-511R | Recombinant Rat ADARB1 Protein | +Inquiry |
XBP1S-01H | Recombinant Human XBP1S, Trx-his-tagged | +Inquiry |
GDF10-3317H | Recombinant Human GDF10 Protein (369-478), His tagged | +Inquiry |
RFL8735HF | Recombinant Full Length Human Olfactory Receptor 52B2(Or52B2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
pepsin -174P | Native Pig pepsin(1:3000) active | +Inquiry |
CTSD-27858TH | Native Human CTSD | +Inquiry |
Thrombin-25H | Active Native Human β-thrombin | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
ApoC-I-3557H | Native Human ApoC-I | +Inquiry |
◆ Cell & Tissue Lysates | ||
NTAN1-3672HCL | Recombinant Human NTAN1 293 Cell Lysate | +Inquiry |
PIGR-2868HCL | Recombinant Human PIGR cell lysate | +Inquiry |
Stomach-486R | Rabbit Stomach Lysate | +Inquiry |
PRKCB-2859HCL | Recombinant Human PRKCB 293 Cell Lysate | +Inquiry |
VGLL1-412HCL | Recombinant Human VGLL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket