Recombinant Full Length Paracoccidioides Brasiliensis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL24697PF |
Product Overview : | Recombinant Full Length Paracoccidioides brasiliensis Formation of crista junctions protein 1(FCJ1) Protein (C1GYK6) (43-685aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Paracoccidioides lutzii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-685) |
Form : | Lyophilized powder |
AA Sequence : | AILQEPNGALRSSSSPSVAAVSDVSQRASNSTNTKRPNTSDLNLRSAASPSTGSTLKPET VLVAPVSPPRQGQTSPGSAASAPEPTAAPPPSPPPTPPTPKTGRLRRFLLYLFLTTGLAY AGGVWYSLRSDNFYDFFTEYAPYGEDAVLYLEERDFRNRFPNATKKNNRRAVTPIDGGAQ VTIPGGSGLSWKVAEEQQEGSDISKKGPHMSAVDKNKATKDTKRVEKTKGGVTSKSPAQR EEAVKTKPATEGVKTQPAKVEETPREPAIPAVTTIDHLVLNTEDEPVVQDLLKVFNDIIT VISADAPSSFSGPVAKAKEELEKIGKRILALKSDAQASAQKEINDAHASFDKSAAKLIRR IDEMRAEDATKFREEFEAERERIAQSYQEKINTELQRVHEVAEQRLRNELVEQAIELNRK FLSDVKNLVEHERESRLSKLAELVSSVAELERLTAGWSDVIDINLKTQQLQVAVDAVRTT LENSNVPRPFIRELAAVKKLASNDEVVSAAIDSISPVAYQRGIPSSAQLVDRFRRVASEV RKASLLPENAGITSHAASFVLSKVMLKKHGSPAGNDVESTLTRAENFLEEGNLDEAAREM NSLKGWAKLLSKDWLADVRRVLEVKQALEVIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; PAAG_03160; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C1GYK6 |
◆ Recombinant Proteins | ||
TRIM38-0418H | Recombinant Human TRIM38 Protein (A2-D465), GST tagged | +Inquiry |
PLXDC1-7408Z | Recombinant Zebrafish PLXDC1 | +Inquiry |
DCDC2A-2228M | Recombinant Mouse DCDC2A Protein, His (Fc)-Avi-tagged | +Inquiry |
SAOUHSC-01763-3787S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01763 protein, His-tagged | +Inquiry |
ATP5H-15892H | Recombinant Human ATP5H, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lysozyme-073H | Native Human Lysozyme Protein | +Inquiry |
A35R-01M | Native Monkeypox virus A35R protein | +Inquiry |
AFP-8027H | Native Human Alpha FetoProtein | +Inquiry |
MMP11-27648TH | Native Human MMP11 | +Inquiry |
F2-647P | Native Pig F2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
PROK1-001HCL | Recombinant Human PROK1 cell lysate | +Inquiry |
HIST2H2BE-5517HCL | Recombinant Human HIST2H2BE 293 Cell Lysate | +Inquiry |
RFC4-2410HCL | Recombinant Human RFC4 293 Cell Lysate | +Inquiry |
RBM42-2468HCL | Recombinant Human RBM42 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket