Recombinant Full Length Aspergillus Clavatus Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL24885AF |
Product Overview : | Recombinant Full Length Aspergillus clavatus Formation of crista junctions protein 1(fcj1) Protein (A1CHB5) (42-628aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Aspergillus clavatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-628) |
Form : | Lyophilized powder |
AA Sequence : | ADVKPPVVPGAPTPASPSSDTPIPPETVPKSTLADEATLPPPPPPPPAPVRKTGRFRRFL IYLILTSGFAYGGGIFLAMKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNANR APKDEGNKVTIPSKSGLSWKVAEEESGADLSAKGPHMSAVEQKGDEAQIKPGTAKPEEKV AAVEKAKSDKPVKEEAPKDTTKVQEEPRKPAVPAVTPIEFATVNEGDEAVVQELVKTFND IITVIGADESAHKFSGTIIKAKDELQKIGEKIIAIRDEARNAAQEEIKEAHATFDESARE LIRRFEEARASDAAQYREEFELEREKLAHAYQEKIRTELLRAQEVAEQRLQNELVEQAIE LNRKYLHEVKDLVEREREGRLSKLNELTTNVTELEKLTTDWKEVIDTNLKTQQLQVAVDA VRSVLERSTVPRPFVRELVAVKELAAEDPVVEAAIASINPTAYQRGIPSTAQIIERFRRV ADEVRKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESILIRTESLLEEGNIDAA AREMNTLKGWAKILSKDWLGDVRRVLEVKQALEVIETEARLQCLRVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; ACLA_047390; MICOS complex subunit mic60; Mitofilin |
UniProt ID | A1CHB5 |
◆ Recombinant Proteins | ||
SDC4-18H | Recombinant Human SDC4 protein | +Inquiry |
RFL29880HF | Recombinant Full Length Human Olfactory Receptor 6F1(Or6F1) Protein, His-Tagged | +Inquiry |
ERH-2848M | Recombinant Mouse ERH Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL23571MF | Recombinant Full Length Mouse Vomeronasal Type-1 Receptor 41(Vmn1R41) Protein, His-Tagged | +Inquiry |
LRRIQ1-4640H | Recombinant Human LRRIQ1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fibronectin-49H | Native Hamster Fibronectin | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
RNASE2-171H | Native Human Eosinophil Derived Neurotoxin | +Inquiry |
LDL-333H | Native Human LDL Protein | +Inquiry |
HP-133B | Native Bovine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR3DX1-981HCL | Recombinant Human KIR3DX1 cell lysate | +Inquiry |
IL23R-1213HCL | Recombinant Human IL23R cell lysate | +Inquiry |
NUFIP1-1229HCL | Recombinant Human NUFIP1 cell lysate | +Inquiry |
C20orf141-8124HCL | Recombinant Human C20orf141 293 Cell Lysate | +Inquiry |
Lymphoma-33H | Human Lymphoma Tumor Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket