Recombinant Full Length Ajellomyces Dermatitidis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL4985BF |
Product Overview : | Recombinant Full Length Ajellomyces dermatitidis Formation of crista junctions protein 1(FCJ1) Protein (C5JIS0) (32-665aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Blastomyces gilchristii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (32-665) |
Form : | Lyophilized powder |
AA Sequence : | SSTPNAAATPELSQKATNSTSTKPPGPNDPDVRSPASPSTGSTLHPETVSKPPQSPAVQG QTSPGSSVQPPEHEPSPPPPRPPPAPKTGLLRKLLYLFLTTGLAYAGGVWYSLRSDNFYD FFTEYIPYGEEAVLYLEERDFRSRFPSIARQINRRVSAPRDEGAQVMIPGRSGLSWKVAE EQQEASDVTKQGQHISATDANELTEETKVAEKAKEDVKSKPVAKKAEAAEPKSSPKVVEP HPAKAEENTSLEAPRQPVVPAAAAIEHLGLDNEDEPVVQDLVKVFNDIITVISADESASK FSVPIAKAKEELEKIGDRIVALKNDAQESAKEEIRNAQAALDKSAAELVRHINEVRAQDA AEFREEFESEREKISKSYQEKVTTELQRAHEVAEQRLRNELVEQAIELNRKFLADVKTLV ENEREGRLSKLAELTANVAELERLTAGWSDVIDINLRTQQLQVAVDSVRTTLENSEVPRP FIRELAAVKELASNDEVVAAAIASISPTAYQRGIPSPAQLVDRFRRVASEVRKASLLPEN AGITSHAASLVLSKVMLKKQGTPVGNDVESILTRTENLLEEGNFDEAAREMNSLQGWAKL LSKDWLADVRRVLEVKQALEVIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; FCJ1; BDBG_02399; MICOS complex subunit MIC60; Formation of crista junctions protein 1; Mitofilin |
UniProt ID | C5JIS0 |
◆ Recombinant Proteins | ||
Sele-1791R | Recombinant Rat Selectin E | +Inquiry |
GRPEL2-5605HF | Recombinant Full Length Human GRPEL2 Protein, GST-tagged | +Inquiry |
YEFA-1008B | Recombinant Bacillus subtilis YEFA protein, His-tagged | +Inquiry |
ESR2-2152R | Recombinant Rat ESR2 Protein | +Inquiry |
RFL12014MF | Recombinant Full Length Macaca Mulatta (Rhesus Macaque) 3 Beta-Hydroxysteroid Dehydrogenase/Delta 5-->4-Isomerase Type 1(Hsd3B1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
NUC-0003 | Native Human Nucleosome | +Inquiry |
APOC2-4904H | Native Human Apolipoprotein CII | +Inquiry |
IGHG3-231H | Native Human Immunoglobulin G3 (IgG3) | +Inquiry |
Vtn -70R | Native Rat multimeric vitronectin | +Inquiry |
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBP4-1517CCL | Recombinant Canine RBP4 cell lysate | +Inquiry |
ZNF621-36HCL | Recombinant Human ZNF621 293 Cell Lysate | +Inquiry |
IMPDH2-5210HCL | Recombinant Human IMPDH2 293 Cell Lysate | +Inquiry |
TARS2-1250HCL | Recombinant Human TARS2 293 Cell Lysate | +Inquiry |
RALY-2540HCL | Recombinant Human RALY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket