Recombinant Full Length Salmonella Typhimurium Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL3115SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Flagellar biosynthetic protein flhB(flhB) Protein (P40727) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MAEESDDDKTEAPTPHRLEKAREEGQIPRSRELTSLLILLVGVCIIWFGGESLARQLAGM LSAGLHFDHRMVNDPNLILGQIILLIKAAMMALLPLIAGVVLVALISPVMLGGLIFSGKS LQPKFSKLNPLPGIKRMFSAQTGAELLKAVLKSTLVGCVTGFYLWHHWPQMMRLMAESPI VAMGNALDLVGLCALLVVLGVIPMVGFDVFFQIFSHLKKLRMSRQDIRDEFKESEGDPHV KGKIRQMQRAAAQRRMMEDVPKADVIVTNPTHYSVALQYDENKMSAPKVVAKGAGLIALR IREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQLKRWRLAGGQR PPQPENLPVPEALDFMNEKNTDG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; STM1914; Flagellar biosynthetic protein FlhB |
UniProt ID | P40727 |
◆ Recombinant Proteins | ||
SLGD-RS00515-5222S | Recombinant Staphylococcus lugdunensis HKU09-01 SLGD_RS00515 protein, His-tagged | +Inquiry |
SDF4-720H | Recombinant Human SDF4 protein, His-tagged | +Inquiry |
HMPREF9015_01858-5793L | Recombinant Leptotrichia wadei HMPREF9015_01858 Protein (Met1-Glu1152), N-His tagged | +Inquiry |
Tnfsf11-474M | Active Recombinant Mouse Tumor Necrosis Factor (Ligand) Superfamily, Member 11 | +Inquiry |
TXNRD2-6379R | Recombinant Rat TXNRD2 Protein | +Inquiry |
◆ Native Proteins | ||
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
GPT-187H | Active Native Human Glutamate Pyruvate Transaminase | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
PLAU-31689TH | Active Native Human Urokinase protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOV-897CCL | Recombinant Canine NOV cell lysate | +Inquiry |
MME-1083RCL | Recombinant Rat MME cell lysate | +Inquiry |
TM4SF5-1033HCL | Recombinant Human TM4SF5 293 Cell Lysate | +Inquiry |
PPOX-2954HCL | Recombinant Human PPOX 293 Cell Lysate | +Inquiry |
DUOXA1-1197HCL | Recombinant Human DUOXA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket