Recombinant Full Length Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL36475YF |
Product Overview : | Recombinant Full Length Flagellar biosynthetic protein flhB(flhB) Protein (Q56886) (1-383aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Yersinia enterocolitica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-383) |
Form : | Lyophilized powder |
AA Sequence : | MAEDSDADKSEEPTAHKLEKAREKGQIPRSRELTSMLMLGAGLAILWVSGESMARQLAAM IAQGLHFDHGLISDDKQMLRQIGMLLRQTLIGLIPIFAGLVIVAMAVPMLLGGVLFSGES IKFDLKRMSPIAGLKRMFSSQALAELLKAILKATLVGWVTGIFLWHNWPDMMRLMAAPPV AALGDALHLIIFCGLVVVLGLTPMVGFDVFFQITSHIKKLRMTKQEIRDEFKDQEGDPHV KGRIRQQQRAMARRRMMADVHKADVIVTNPTHYAVALQYNETKMSAPKVLAKGAGAVALR IRELGAEHRIPLLEAPPLARALFRHSEVGQHIPATLYAAVAEVLAWVYQLKRWKREGGLI PKKPEHLPVPEGLDFATEESETD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; Flagellar biosynthetic protein FlhB |
UniProt ID | Q56886 |
◆ Recombinant Proteins | ||
AYP1020-RS00800-6208S | Recombinant Staphylococcus capitis subsp. capitis (strain: AYP1020, sub-species: capitis) AYP1020_RS00800 protein, His-tagged | +Inquiry |
PARK7-30783TH | Recombinant Human PARK7 | +Inquiry |
CFDP1-3345M | Recombinant Mouse CFDP1 Protein | +Inquiry |
RPOZ-3209S | Recombinant Staphylococcus epidermidis ATCC 12228 RPOZ protein, His-tagged | +Inquiry |
KIAA0020-3086C | Recombinant Chicken KIAA0020 | +Inquiry |
◆ Native Proteins | ||
pla-001H | Human Protein S Deficient Plasma | +Inquiry |
Lectin-1737W | Active Native Wheat Germ Agglutinin Protein, Peroxidase conjugated | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
PLG -37D | Native Canine plasminogen | +Inquiry |
CRP-158R | Native Rabbit C-Reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RBPJ-2454HCL | Recombinant Human RBPJ 293 Cell Lysate | +Inquiry |
SOX9-1555HCL | Recombinant Human SOX9 293 Cell Lysate | +Inquiry |
LIFR-2778HCL | Recombinant Human LIFR cell lysate | +Inquiry |
TNFRSF1B-2192MCL | Recombinant Mouse TNFRSF1B cell lysate | +Inquiry |
ICOS-2444HCL | Recombinant Human ICOS cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket