Recombinant Full Length Treponema Pallidum Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL15851TF |
Product Overview : | Recombinant Full Length Treponema pallidum Flagellar biosynthetic protein flhB(flhB) Protein (O83710) (1-376aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-376) |
Form : | Lyophilized powder |
AA Sequence : | MIEQEGTFPLPLFIIDLQWFAAEDEGRSEDPTETKLRKAREEGRVPKSQDLNGAFVMLFT STSLFLLAPFILRECIGVLRFFFTRATTASIQNTGWFFVFVRYFMKLALPISFVALVSGV AANIVQNKTVLFSVKSIRPQFKKISPDVIRFFKRSFFSTEGLFNLLKSLIKITAIFFVSY FTIRNDLFMFVSLLGVSLTQSIFYITSLAGKVLLEVSLLLVVFSLPDYFFQRRQFIDSLK MSRQEVKEELKEQEGDPLVRSYVRKQMQSLVRESARNTTDADVVITNPTHFAVAVQYEPA YMTAPTVVAKGSDGTAYRIKRLAKEAGILIEENKPLARALYTQVAIGREVPYEYFNALVL IFTKLDKFKTHAQRKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; TP_0715; Flagellar biosynthetic protein FlhB |
UniProt ID | O83710 |
◆ Recombinant Proteins | ||
NI36-RS07575-1123S | Recombinant Staphylococcus aureus (strain: MS4, nat-host: Homo sapiens) NI36_RS07575 protein, His-tagged | +Inquiry |
TMEM219-16999M | Recombinant Mouse TMEM219 Protein | +Inquiry |
CAMK2B-10682H | Recombinant Human CAMK2B, GST-tagged | +Inquiry |
PRKX-749H | Recombinant Human PRKX Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ODAM-4155R | Recombinant Rat ODAM Protein | +Inquiry |
◆ Native Proteins | ||
Pertussis-37 | Native Pertussis Toxin Antigen | +Inquiry |
IgM-210R | Native Rabbit IgM | +Inquiry |
HPIV2ag-272V | Native Parainfluenza Virus type 2(strain II ALTB cc 2056) Protein | +Inquiry |
CKMB-12H | Active Native Human Creatine Kinase MB protein | +Inquiry |
BCHE-26067TH | Native Human BCHE | +Inquiry |
◆ Cell & Tissue Lysates | ||
COPZ1-7351HCL | Recombinant Human COPZ1 293 Cell Lysate | +Inquiry |
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
EHD4-6688HCL | Recombinant Human EHD4 293 Cell Lysate | +Inquiry |
RAB3B-522HCL | Recombinant Human RAB3B lysate | +Inquiry |
COX10-387HCL | Recombinant Human COX10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket