Recombinant Full Length Buchnera Aphidicola Subsp. Schizaphis Graminum Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL10025BF |
Product Overview : | Recombinant Full Length Buchnera aphidicola subsp. Schizaphis graminum Flagellar biosynthetic protein flhB(flhB) Protein (Q8K9S1) (1-381aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Buchnera Aphidicola Subsp. Schizaphis Graminum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-381) |
Form : | Lyophilized powder |
AA Sequence : | MNHDINEEKTEQPTEHHIKKFRKKGETRYSRELNSLLILIFGLSNLWWSRYSIIFELKTI MFNSFNFNQNILTNQQNISLNFFFFIKKILIVFFPFFSFLICIIIIPPILFGGIKFNFTS LKLNFARLNLLHGLKKFFSFQIFIELFKTTLKLFIISCISIFYLWIYFYKILFLSTKNIS SSLLDGFNVIFYCCILIILGLIPIVILDVFWRQWSYYKKLKMTHQEIKDEFKEREGSPQI KARIRQQMKINLRRRMISDVPKADVIITNPIHYAIALKYDIHKMNAPKVIAKGIGATAMK IQKIALKNGIAIIASPSLARALYRYSEIGQYIPGPLYKAVAEILAWVWKVKKWKREGGIF PEKPKNISVPSELNVTGESND |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; BUsg_235; Flagellar biosynthetic protein FlhB |
UniProt ID | Q8K9S1 |
◆ Recombinant Proteins | ||
BIN1-641R | Recombinant Rat BIN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IFNA3-6978C | Recombinant Chicken IFNA3 | +Inquiry |
ABHD12-2089C | Recombinant Chicken ABHD12 | +Inquiry |
SLC2A3-0478H | Recombinant Human SLC2A3 Protein (G2-V496), 8×His-Strep, Flag tagged | +Inquiry |
CD163-94P | Recombinant Porcine CD163 | +Inquiry |
◆ Native Proteins | ||
EGF-23H | Active Native Human EGF protein | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
F2-647P | Native Pig F2 | +Inquiry |
CAT-1646H | Native Human Catalase Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
GATAD1-6008HCL | Recombinant Human GATAD1 293 Cell Lysate | +Inquiry |
CHST1-7509HCL | Recombinant Human CHST1 293 Cell Lysate | +Inquiry |
HMGB2-5477HCL | Recombinant Human HMGB2 293 Cell Lysate | +Inquiry |
GATAD2B-6007HCL | Recombinant Human GATAD2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket