Recombinant Full Length Borrelia Burgdorferi Flagellar Biosynthetic Protein Flhb(Flhb) Protein, His-Tagged
Cat.No. : | RFL7049BF |
Product Overview : | Recombinant Full Length Borrelia burgdorferi Flagellar biosynthetic protein flhB(flhB) Protein (Q44760) (1-372aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Borrelia Burgdorferi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-372) |
Form : | Lyophilized powder |
AA Sequence : | MIKDEFLIKSWYIPLDFFSADDEGRTELPTDQKKQKAREEGRVLKSTEINTAVSLLLLFA LFFFMLSYFALDLIAVFKEQAIKLPEVMRMSVYTMGFAYIRSIMGYVVLFFFASLAVNFF VNIIQVGFFITFKSLEPRWDKISFNFSRWAKNSFFSAGAFFNLFKSLLKVVIICLIYYFI IENNIGKISKLSEYTLQSGISIVLVIAYKICFFSVMFLAIVGVFDYLFQRSQYIESLKMT KEEVKQERKEMEGDPLLRSRIKERMRVILSTNLRVAIPQADVVITNPEHFAVAIKWDSET MLAPKVLAKGQDEIALTIKKIARENNVPLMENKLLARALYANVKVNEEIPREYWEIVSKI LVRVYSITKKFN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | flhB |
Synonyms | flhB; BB_0272; Flagellar biosynthetic protein FlhB |
UniProt ID | Q44760 |
◆ Recombinant Proteins | ||
TNFSF13-1517H | Recombinant Human TNFSF13 protein, His-Avi&Flag-tagged, Biotinylated | +Inquiry |
OR4D11-3198R | Recombinant Rhesus monkey OR4D11 Protein, His-tagged | +Inquiry |
Rfk-5478M | Recombinant Mouse Rfk Protein, Myc/DDK-tagged | +Inquiry |
MACROD1-4379H | Recombinant Human MACROD1 protein, His&Myc-tagged | +Inquiry |
RPS6KB1-2422C | Recombinant Chicken RPS6KB1 | +Inquiry |
◆ Native Proteins | ||
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
Lactate dehydrogenase-039B | Active Native Bovine Lactate dehydrogenase Protein | +Inquiry |
KLC1-5355H | Native Human Kinesin Light Chain 1 | +Inquiry |
ALPP-8005H | Native Human Placental Alkaline Phosphatase | +Inquiry |
HP-191E | Native Equine Haptoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
NUDC-3658HCL | Recombinant Human NUDC 293 Cell Lysate | +Inquiry |
SERPINB2-652HCL | Recombinant Human SERPINB2 cell lysate | +Inquiry |
CCDC85B-161HCL | Recombinant Human CCDC85B lysate | +Inquiry |
GINS1-5934HCL | Recombinant Human GINS1 293 Cell Lysate | +Inquiry |
SPATA24-4699HCL | Recombinant Human LOC202051 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All flhB Products
Required fields are marked with *
My Review for All flhB Products
Required fields are marked with *
0
Inquiry Basket