Recombinant Full Length Salmonella Typhi Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL36810SF |
Product Overview : | Recombinant Full Length Salmonella typhi Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (P63360) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; STY0985; t1950; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | P63360 |
◆ Recombinant Proteins | ||
MCM5-3254H | Recombinant Human MCM5 protein, His-tagged | +Inquiry |
PI4K2B-160H | Active Recombinant Human PI4K2B protein, GST-tagged | +Inquiry |
Gip-3212M | Recombinant Mouse Gip Protein, Myc/DDK-tagged | +Inquiry |
SUH-0004P2-4297S | Recombinant Staphylococcus aureus (strain: 18808) SUH_0004P2 protein, His-tagged | +Inquiry |
TPRN-3551HF | Recombinant Full Length Human TPRN Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-5399H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
CEN-27 | Active Native Cholesterol esterase | +Inquiry |
LDH5-24H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
APOB-613H | Native Human Apolipoprotein B (including Ag(x) antigen) | +Inquiry |
LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASF1A-8653HCL | Recombinant Human ASF1A 293 Cell Lysate | +Inquiry |
USP4-456HCL | Recombinant Human USP4 293 Cell Lysate | +Inquiry |
SNAPIN-1635HCL | Recombinant Human SNAPIN 293 Cell Lysate | +Inquiry |
INTS12-5188HCL | Recombinant Human INTS12 293 Cell Lysate | +Inquiry |
TSPAN18-709HCL | Recombinant Human TSPAN18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket