Recombinant Full Length Photorhabdus Luminescens Subsp. Laumondii Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL16588PF |
Product Overview : | Recombinant Full Length Photorhabdus luminescens subsp. laumondii Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q7N6C6) (1-581aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Photorhabdus luminescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-581) |
Form : | Lyophilized powder |
AA Sequence : | MNDKDLSTWQTFCRLWPIVSPFRIGLIVAAVALILNAAGDTLMLSLLKPLLDEGFGKASS DVLKWMPLIVIALMIMRGLSGFVSSYCISWVSGKVVMQMRRRLFSHMMGMPVSFFDQQST GTLLSRITYDSEQVASSSSSALITVVREGASIIGLFVLMFYYSWQLSLILIVIAPIVSLV IRVVSKRFRSISKNMQNSMGQVTASAEQMLKGHKEVLIFGGQNVETERFNKVSNHMRQQG MKMVSASSISDPIIQLIASFALAFVLYAASFPDIMETLTAGKITVVFSSMIALMRPLKSL TNVNAQFQRGMAACQTLFSILDMEQEKDDGKLELKKANGDIEFRNVTFCYPTKELPALQN ISMYIPAGKIVALVGRSGSGKSTIANLLTRFYDVNEGNIFLDGHDLREYKLSSLRGQVAL VSQNVHLFNDTVANNIAYASENRYSREEIEKAAEMAYAMDFIRKLDNGLDTMIGENGVLL SGGQRQRIAIARALLRDSPVLILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLST IENADEILVVEDGHIVERGDHLSLLERNGVYSQLHRMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; plu1630; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q7N6C6 |
◆ Native Proteins | ||
FTH1-28155TH | Native Human FTH1 | +Inquiry |
Fgg-5421R | Native Rat Fibrinogen Gamma Chain | +Inquiry |
Lectin-1731R | Active Native Ricinus Communis Agglutinin I Protein, Rhodamine labeled | +Inquiry |
LPA-8453H | Native Human LPA | +Inquiry |
ALB-112P | Native Pigeon Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
Jurkat-010HCL | Human Jurkat Whole Cell Lysate | +Inquiry |
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
OLFM2-3582HCL | Recombinant Human OLFM2 293 Cell Lysate | +Inquiry |
DDR2-2172MCL | Recombinant Mouse DDR2 cell lysate | +Inquiry |
ANKH-8861HCL | Recombinant Human ANKH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket