Recombinant Full Length Hahella Chejuensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL20080HF |
Product Overview : | Recombinant Full Length Hahella chejuensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q2SIN5) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hahella chejuensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MSKVAKQYAGAQVYGRLLSYLKPLWKVFALAVLGNVIYALASAAMADATKYIVAAIETPS PEGRLLVPMLIIGIFALRGLGSFCGGYFMARVARGIVHRMRLELFRHLTVLPCRFFDSNS TGHLVSRITYNVDQVTGAATNAITVVLREGFTVIGLMGYMIYVSWKLTLLFLVLGPIIGV LIGYVSKRFRRISRRIQSSMGDVTHVASESIGGYRVMRTFGGEEYEFNRFMKASEYNITQ ALKMSLTQALSTPIIQLVISVFIALLVWLALSPEVRGNMSTGEFLAYITAATTCAKPIRQ LTEVNAVIQRGISAAQDVFMQLDEPVEKDEGSYVADRVQGRLEFKSLGFAYSDEGKPALQ EINLVIEPGETVALVGRSGSGKSTLVNLLPRFYDYEQGEILLDGKPLKDFALTSLRRQIS IVTQQVVLFNDTVTNNIAYGALADATPEQVREAAKSADALGFIEQLEQGFDTLLGENGTR LSGGQRQRMVIARALLKDSPILILDEATSALDTHAERNIQSALETLMKGRTTLVVAHRLS TIENADKIVVMDQGRIVEVGSHRELIEKDGAYAALHKLQFSEADA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; HCH_02703; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q2SIN5 |
◆ Recombinant Proteins | ||
CD81-0527H | Active Recombinant Human CD81 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
S100A13-3722H | Recombinant Human S100A13, His-tagged | +Inquiry |
SAOUHSC-01739-4639S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01739 protein, His-tagged | +Inquiry |
C5-1287H | Recombinant Human C5 protein | +Inquiry |
RFL2704DF | Recombinant Full Length Drosophila Melanogaster Putative Odorant Receptor 19A(Or19A) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
IBV-06I | Native Influenza B Antigen | +Inquiry |
Colon-009H | Human Colon Lysate, Total Protein | +Inquiry |
FN1-3B | Active Bovine Fibronectin, carrier free | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCRL1-1379MCL | Recombinant Mouse FCRL1 cell lysate | +Inquiry |
SkeletalMuscles-441S | Sheep Skeletal Muscles Lysate, Total Protein | +Inquiry |
SLITRK3-1682HCL | Recombinant Human SLITRK3 293 Cell Lysate | +Inquiry |
MYBPHL-4040HCL | Recombinant Human MYBPHL 293 Cell Lysate | +Inquiry |
TSSK1B-694HCL | Recombinant Human TSSK1B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket