Recombinant Full Length Pseudomonas Fluorescens Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL31527PF |
Product Overview : | Recombinant Full Length Pseudomonas fluorescens Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q4KJB2) (1-601aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas fluorescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-601) |
Form : | Lyophilized powder |
AA Sequence : | MTDSSPDASPSSLKIYFRLLGYVRPYIGLFLISIVGFLIFASTQPMLGYILKYFVDGLSN PQAVLFPGVPYLRDMQLLQAVPLLIVLIAAWQGLGSYLGNYFLAKVSLGLVHDLRVQLFN NLLTLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIREGMTVIFLFGSLLWMNWR LTLVMIAILPLIAVMVRTASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGETYE QQRFLAASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAVLMFLVLYLRGDASAGEMVAYI TMAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEVDRGTVERASINGHLEVRNLS FTYPGTERQVLDDISFSIEPGKMVALVGRSGSGKSTLANLIPRFYHHDKGQILLDGTEVE DFRLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAPREDIEKAAADAYAMDFIAQLPE GLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDKVMK GRTTLVIAHRLSTIEKADLILVMDQGRIVERGSHAQLLAQNGYYSRLHAMGLEEPAPSGI A |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PFL_0527; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q4KJB2 |
◆ Recombinant Proteins | ||
GNG4-3775M | Recombinant Mouse GNG4 Protein, His (Fc)-Avi-tagged | +Inquiry |
LY6H-4568H | Recombinant Human LY6H Protein, GST-tagged | +Inquiry |
MPXV-0507 | Recombinant Monkeypox Virus F2L Protein | +Inquiry |
PCYT1A-549HFL | Recombinant Full Length Human PCYT1A Protein, C-Flag-tagged | +Inquiry |
RFL2539KF | Recombinant Full Length Klebsiella Pneumoniae Subsp. Pneumoniae Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
Hemopexin-035B | Native Bovine Hemopexin Protein | +Inquiry |
HRP-002 | HRP, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NAPRT1-1165HCL | Recombinant Human NAPRT1 cell lysate | +Inquiry |
ELP4-6615HCL | Recombinant Human ELP4 293 Cell Lysate | +Inquiry |
AHSA2-8960HCL | Recombinant Human AHSA2 293 Cell Lysate | +Inquiry |
TBCA-1220HCL | Recombinant Human TBCA 293 Cell Lysate | +Inquiry |
PRDM1-2890HCL | Recombinant Human PR domain containing 1 cell lysate, transcript variant 2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket