Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL2874VF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8DAV2) (1-583aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio Vulnificus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-583) |
Form : | Lyophilized powder |
AA Sequence : | MSINTDESTWRTFKRLWTFIRLYKSGLAVAVVALIINAVSDTYMVSLLKPLLDEGFGSAE SDFLRTLPLLVFGLMFIRGISSFVSTYCLSWVSGNVVMQVRRMVFNHYMQMPVSYFDKEK SGSLLSRITYDSEQVSAATSQALVSIVREGTSIIGLLVLMFYNSWQLSLVLILVAPVVAW AIGFVSKRFRKISKNMQTTMGIVTSSAEQMLKGHKVVLSYGGQEVEKSRFDVVSNQMRQQ SMKLITAQAAANPIIQMIASIAIVVVLYLASVDTIKDQLTPGTFTVVFSAMFGLMRPLKA LTNVTSQFQRGMAAAQTLFALVDLEPEKNTGTYSVERAKGEVNVKDISFTYEGAEKPALS HVSFDIPRGKTVALVGRSGSGKSTIANLFTRFYDVDSGEIQLDGVDVRDYELKNLRTQFA LVSQNVHLFNDTIANNIAYAAGDKYSREDIERAAELAHAMEFISKMENGLDTMVGENGAS LSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQSALDELQKNKTVLVIAHRLS TIEKADQILVIDDGSVVERGSHSELIEKDGAYAQLHRIQFGEG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; VV1_2085; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8DAV2 |
◆ Recombinant Proteins | ||
Rgma-2417M | Recombinant Mouse RGM Domain Family, Member A, FLAG-tagged | +Inquiry |
GPR15-3856M | Recombinant Mouse GPR15 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADCYAP1R1A-7251Z | Recombinant Zebrafish ADCYAP1R1A | +Inquiry |
HMPREF0798-RS10395-1371S | Recombinant Staphylococcus hominis subsp. hominis C80 HMPREF0798_RS10395 protein, His-tagged | +Inquiry |
PTPLB-3702R | Recombinant Rhesus monkey PTPLB Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-206M | Native Monkey Immunoglobulin G | +Inquiry |
IgGF-330C | Native Chicken IgG Fab | +Inquiry |
Calprotectin-12HFL | Native Human Calprotectin Protein | +Inquiry |
CTSL1-27406TH | Native Human CTSL1 | +Inquiry |
Factor Xia-65H | Native Human Factor Xia | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHC2-1342HCL | Recombinant Human PHC2 cell lysate | +Inquiry |
GSTA1-5719HCL | Recombinant Human GSTA1 293 Cell Lysate | +Inquiry |
GMPPB-5878HCL | Recombinant Human GMPPB 293 Cell Lysate | +Inquiry |
PRLH-2843HCL | Recombinant Human PRLH 293 Cell Lysate | +Inquiry |
TEX9-1138HCL | Recombinant Human TEX9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket