Recombinant Full Length Burkholderia Pseudomallei Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL34686BF |
Product Overview : | Recombinant Full Length Burkholderia pseudomallei Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q3JUI6) (1-596aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia pseudomallei |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-596) |
Form : | Lyophilized powder |
AA Sequence : | MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVTITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGEPYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSANDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGMSRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGSVRVDGVAL PEYSLRDLRNQIAMVSQDVVLFNDTIAANVAYGQAPERDRVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BURPS1710b_1357; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q3JUI6 |
◆ Recombinant Proteins | ||
CHMP6B-1161Z | Recombinant Zebrafish CHMP6B | +Inquiry |
CHRNA4-22H | Recombinant Human CHRNA4 protein, GST-tagged | +Inquiry |
BHLHA15-4817Z | Recombinant Zebrafish BHLHA15 | +Inquiry |
SAOUHSC-01719-4638S | Recombinant Staphylococcus aureus subsp. aureus NCTC 8325 SAOUHSC_01719 protein, His-tagged | +Inquiry |
NOS2-298H | Recombinant Human NOS2 | +Inquiry |
◆ Native Proteins | ||
ALB-314H | Native Human Albumin Fluorescein | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
Lectin-1831R | Active Native Ricinus Communis Agglutinin I Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
C1orf35-8159HCL | Recombinant Human C1orf35 293 Cell Lysate | +Inquiry |
EMILIN1-553HCL | Recombinant Human EMILIN1 cell lysate | +Inquiry |
FAM82B-6345HCL | Recombinant Human FAM82B 293 Cell Lysate | +Inquiry |
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
KLHL13-4912HCL | Recombinant Human KLHL13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket