Recombinant Full Length Saccharomyces Cerevisiae Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL21181SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1) Protein (C8ZCI0) (17-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-539) |
Form : | Lyophilized powder |
AA Sequence : | ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANGVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; EC1118_1K5_2740g; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C8ZCI0 |
◆ Recombinant Proteins | ||
PTH2R-4820R | Recombinant Rat PTH2R Protein | +Inquiry |
YJEFN3-3777H | Recombinant Human YJEFN3 protein | +Inquiry |
MYOZ2-4861H | Recombinant Human MYOZ2 Protein (Met1-Leu264), C-His tagged | +Inquiry |
Sfrp2-223M | Active Recombinant Mouse Sfrp2, His-tagged | +Inquiry |
E5S66-5634T | Recombinant Thermomonas fusca E5S66 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
Complement C4-50H | Native Human Complement C4 | +Inquiry |
ADVag-271V | Active Native ADV(Type 6, strain Tonsil 99) Protein | +Inquiry |
FTL-26944TH | Native Human FTL | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
TCN1-1171HCL | Recombinant Human TCN1 293 Cell Lysate | +Inquiry |
PRSS50-2801HCL | Recombinant Human PRSS50 293 Cell Lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
CCDC117-7786HCL | Recombinant Human CCDC117 293 Cell Lysate | +Inquiry |
CYorf15B-7132HCL | Recombinant Human CYorf15B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket