Recombinant Full Length Candida Albicans Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL17107CF |
Product Overview : | Recombinant Full Length Candida albicans Formation of crista junctions protein 1(FCJ1) Protein (Q5A044) (26-567aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Candida albicans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-567) |
Form : | Lyophilized powder |
AA Sequence : | NNAPKVVSPPVPPPVKPQRSEIPPPPPPPPPPPKAKRFSLFGFLFKTTLLATVVYGGTLY AATKNDKVMDFVIDKQLPFHEELIDLIENGSTEDLQEAWEHLKNKFTDVKLPTKDDIDEL TQKLEHRGEDIIKETKKKIASTHIGHKSGTDLTPTEQLQRGVEIESVKKDVAHLPLIELN SDLGKSVDETVKQTITSFNNFIQSIDASSLATKDDKLITSINTSVNQLASRLNSLTKDFD NELQNKLKVSQTELFSSFTKKELELTENLLHQFSTEKQQLEAKLNQKLSQEIQAARAAIS QAASNAVAMVRIEQTKNFEKLVSEKLNEERNGRLANLEKLNDRIVELEKFAEGFETQIVS NHKKAIIHQAVSKLKSLLLAPAVGDKPQPIKPYIDELTKIATDDEVLALAIKDLSPLITN ESTHSILTNAQLLSRWEQLAPELRSASLLPPNAGLLGHLASIVFSKLLLPVKGVKEDGKD IESVIGRVESSLARGELDIAVEEAANLKGWSRKLANDWVVEGRKRLEIEFLLGLIESESK II |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; FMP13; CAALFM_CR03530WA; CaO19.11874; CaO19.4396; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q5A044 |
◆ Recombinant Proteins | ||
FOXD4-5055HF | Recombinant Full Length Human FOXD4 Protein, GST-tagged | +Inquiry |
BRDT-37H | Active Recombinant Human BRDT, His&FLAG-tagged | +Inquiry |
Fgfr2-501MAF555 | Recombinant Mouse Fgfr2 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
PNCK-4544R | Recombinant Rat PNCK Protein | +Inquiry |
BRD7-2836H | Recombinant Human BRD7 protein, His&FLAG-tagged | +Inquiry |
◆ Native Proteins | ||
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
C1q-07R | Native Rat C1q Protein | +Inquiry |
ASOM-37 | Active Native L-ascorbate oxidase | +Inquiry |
ALPI-5B | Active Native Bovine Alkaline Phosphatase | +Inquiry |
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF138-2298HCL | Recombinant Human RNF138 293 Cell Lysate | +Inquiry |
IL2RA-2024MCL | Recombinant Mouse IL2RA cell lysate | +Inquiry |
ADAM9-1750MCL | Recombinant Mouse ADAM9 cell lysate | +Inquiry |
MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry |
PLEK2-3118HCL | Recombinant Human PLEK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket