Recombinant Full Length Uncinocarpus Reesii Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL8381UF |
Product Overview : | Recombinant Full Length Uncinocarpus reesii Formation of crista junctions protein 1(FCJ1) Protein (C4JHS3) (30-668aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Uncinocarpus reesii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (30-668) |
Form : | Lyophilized powder |
AA Sequence : | SRVRSPAAVSKGIPAFTPRGHAFTTSARLANDPNIRSPPSPSSESTIPPESVPRPPPSHP IQTSPGSTIEGRTQPPPPPPVTNTPPPPPPPPPPAPKKGGRLRRLLIYLILTTGLAYAGG VWLSLKSDNFHDFFTEYIPYGEEAVLYVEEQDFRRRFPNATKQISRRAVEPRDEGQNVTI PGKSGVSWRVSEGQKETKEDGSDVSRRGKHMSATEANTAKEATKTSTVEETKAKKQVESA APTTEKKSASETVKPALEEPRAPAIPTIDSVEPLSMLVDEPTVQELTKIVNDLIAVINAD ESSSRFTSTLSKAKADFQRLGEQIAVLRQDAQDAARVEIENARAEMERTANELIRRIDEV RAEDAAQFREEYESERERLANAYQEKIKTELQRVQEVAEQRLRNELVEQAIELNRKFLSD VRSLVEKEREGRLSKLSELTANVGELEKLTAEWNSVVDTNLNTQQLQVAVDAVRSALENS DIPKPFINELVAVKELASDDQVVDAAISSISPVAYQRGIPSPAQIVERFRRLATEVRKAS LLPENAGIASHAASYMASKVMFKKQGSDDGDDVESILTRTENLLEEGRLDEAAREMNSLQ GWSKILSKDWLADVRRVLEVKQALEIIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; UREG_02759; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C4JHS3 |
◆ Recombinant Proteins | ||
RFL35126HF | Recombinant Full Length Human E-Selectin(Sele) Protein, His-Tagged | +Inquiry |
P2RX8-9889Z | Recombinant Zebrafish P2RX8 | +Inquiry |
Ttr-731R | Recombinant Rat Ttr protein, His-tagged | +Inquiry |
AP1S1-649H | Recombinant Human AP1S1 protein, GST-tagged | +Inquiry |
TBPL2-5972R | Recombinant Rat TBPL2 Protein | +Inquiry |
◆ Native Proteins | ||
GOT1-5351H | Native Human Glutamic-Oxaloacetic Transaminase 1, Soluble (aspartate aminotransferase 1) | +Inquiry |
F2-274B | Active Native Bovine α-Thrombin | +Inquiry |
FGG-53S | Native Sheep Fibrinogen | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
ApoE-3560H | Native Human ApoE | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTBR-1229CCL | Recombinant Cynomolgus LTBR cell lysate | +Inquiry |
KRT32-961HCL | Recombinant Human KRT32 cell lysate | +Inquiry |
RAB3C-2598HCL | Recombinant Human RAB3C 293 Cell Lysate | +Inquiry |
MGAT1-4343HCL | Recombinant Human MGAT1 293 Cell Lysate | +Inquiry |
FAM206A-7927HCL | Recombinant Human C9orf6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket