Recombinant Full Length Saccharomyces Cerevisiae Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL29904SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Formation of crista junctions protein 1(FCJ1) Protein (A6ZZY0) (17-539aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (17-539) |
Form : | Lyophilized powder |
AA Sequence : | ASINTGTTVASKKASHKFRNTFWTIALSATAFYAGGIIYSQKNDKFGDFFSNNVPFAEDL LETYEHYHDRPTLFLEDSWDGLKAKSNDLLSGLTGSSQTRRSNRENIEVKKILSLEPLNI ETENSDPQLKEIIGSLNDLINSLNDSNLSIPESEFNSIKKSNQNMLTNLSQLNETLKEAL SNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDEFKENLTKQKDKELEEKLKAN EELLQAKHANEVGLLSITQVKEFNKIIKDKIEKERNGRLAHLEEINSEVNDLSKSIDRSS KILSKNEALVQLTFQVDEIKSRINNNNLPDVNIDKELSRLKLLSNLLSTFNKKSCCDDGD CCSCKKGNKNEGKEGKISCKCKPKTNPPSLLSVALDELESTCSGKKILSNEQIYNRWNLL ADDFKTASLLPPNSGILGQLTAKVFSLFLFTKTGNPSNATDFDSVYARVGDNLRVSNLND AVEEVVSLKGWPHKVCESWIEDARRKLEVQRLVEILDCEIRTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; SCY_3390; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | A6ZZY0 |
◆ Recombinant Proteins | ||
BI-1-1622N | Recombinant Nicotiana tabacum BI-1 Protein (Full Length), C-His tagged | +Inquiry |
USF1-30031TH | Recombinant Human USF1 | +Inquiry |
ENPP2-076H | Recombinant Human ENPP2 Protein, His-tagged | +Inquiry |
HYKK-2383H | Recombinant Human HYKK Protein, MYC/DDK-tagged | +Inquiry |
SCO2050-486S | Recombinant Streptomyces coelicolor A3(2) SCO2050 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
COL6A1-001B | Native Bovine COL6A1 Protein | +Inquiry |
Fixa-278B | Active Native Bovine Factor Ixa | +Inquiry |
SAP6-91 | Active Native Saponaria Officinalis SAP6 | +Inquiry |
◆ Cell & Tissue Lysates | ||
Brain-485C | Chicken Brain Lysate, Total Protein | +Inquiry |
ZNF789-9HCL | Recombinant Human ZNF789 293 Cell Lysate | +Inquiry |
TLR6-1044HCL | Recombinant Human TLR6 293 Cell Lysate | +Inquiry |
TMCC1-1028HCL | Recombinant Human TMCC1 293 Cell Lysate | +Inquiry |
SNAPC2-1653HCL | Recombinant Human SNAPC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket