Recombinant Full Length Ajellomyces Capsulata Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL3967AF |
Product Overview : | Recombinant Full Length Ajellomyces capsulata Formation of crista junctions protein 1(FCJ1) Protein (A6RBC5) (20-666aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (20-666) |
Form : | Lyophilized powder |
AA Sequence : | ALARKSNAGRRCSLTPNSATASQFFQKAASSTSTKPPGPSDADVRSPASPSSRSSLRPES IPKPPQSPPVQGQTSPGSEVLPPDHESSTPPPPPPPPQGPKSSRLRKLLYLFLTAGLAYA GGVWYSLRSDNFYDFFTEYIPYGEEAVLYLEERDFRNRFPHVTKQINRRVTVPKDEGAQV TIPSGSGLSWKVAEEQQEATDMTKKGRRMGTAHANEPTKDIKVAEKAKEEVKSKSAAKKE DVAANIPIQEDLEPQPAKAEERNLDAPRQPAVPAATTIERLVQDKVDEPVVQDLVKVFND VISVISADESASKFAGPIAKAKEELQRIGDRIVALKKDAQESAQEEIRNAHAAFDKSAAE LIRRIDEVRTQDAAEFREEFESEREKIARSYQEKVNTELQRAHEVAEQRLRNELVEQAIE LNRKFLSDVKTLVENEREGRLSKLAELTANVAELERLTAGWSDVVDINLKTQQLQVAVDA VRTTLENSDVPRPFVRELAAVKELASNDEVVAAAIASISPAAYQRGIPSAAQLVERFRRV ASEVRKASLLPENAGITSHAASLVLSKVMLKKQGLPTGDDVESILTRTENFLEEGNFDEA AREMNSLQGWAKLLSKDWLADVRQVLEVKQALEIIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; HCAG_06263; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | A6RBC5 |
◆ Recombinant Proteins | ||
UGT2A3-17814M | Recombinant Mouse UGT2A3 Protein | +Inquiry |
CBFB-9893Z | Recombinant Zebrafish CBFB | +Inquiry |
KLF17-169H | Recombinant Human KLF17 protein, T7/His-tagged | +Inquiry |
GPX5-2334R | Recombinant Rat GPX5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CASP7-508H | Recombinant Human CASP7 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen type I & III-185 | Native Porcine Collagen type I & III Protein | +Inquiry |
VTN-5410H | Native Human Vitronectin | +Inquiry |
LDL-1538H | Native Human Low-density lipoprotein | +Inquiry |
Bone Marrow-007H | Human Bone Marrow Lysate, Total Protein | +Inquiry |
LTF-4771H | Native Human Lactotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2315HCL | Recombinant H5N8 HA cell lysate | +Inquiry |
PSMB2-2774HCL | Recombinant Human PSMB2 293 Cell Lysate | +Inquiry |
OAZ3-1243HCL | Recombinant Human OAZ3 cell lysate | +Inquiry |
TRPC4AP-743HCL | Recombinant Human TRPC4AP 293 Cell Lysate | +Inquiry |
ARFIP1-8751HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket