Recombinant Full Length Ajellomyces Capsulata Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL12999AF |
Product Overview : | Recombinant Full Length Ajellomyces capsulata Formation of crista junctions protein 1(FCJ1) Protein (C6H203) (43-686aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ajellomyces capsulatus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (43-686) |
Form : | Lyophilized powder |
AA Sequence : | ALARKSNAGRRCPLTPNTATTSQFFQKAASSTSTKPPGPSDADVRSPASPSSRFSLRPES IPKTPQSPPVQGQTSPGSEVLPPDHESSTPPPPLEGPKSSRLRKLLYLFLTAGLAYAGGV WYSLRSDNFYDFFTEYIPYGEEAVLYLEERDFRNRFPHVTKQINRRVTVPKDEGAQVTIP SGSGLSWKVAEEQQEATDMTKKGRRMGTAHANEPTKDIKVAEKAKEEVKSKSAAKKEDVA ANIPIQEALEPQPAKAEEKNLEAPRQPAVPAVTAIERLVQDKVDEPVVQDLVKVFNDVIS VISADESASKFAGPIAKAKEELQRIGDRIVALKKDAQESAQEEIRNAHAAFDKSAAELIR RIDEVRTQDAAEFREEFESEREKIARSYQEKVNTELQRAHEVAEQRLRNELVEQAIELNR KFLSDVKTLVENEREGRLSKLAELSANVAELERLTAGWSDVVDINLKTQQLQVAVDAVRT TLENSDVPRPFVRELAAVKELASNDEVVAAAIASISPAAYQRGIPSAAQLVDRFRRVASE VRKASLLPENAGITSHAASLVLSKVMLKKQGLPTSDDVESILTRTANFLEEGNFDEAARE MNSLQGWAKLLSKDWLADVRRVLEVKQALEIIETEARLRCLQVE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; HCDG_00735; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | C6H203 |
◆ Recombinant Proteins | ||
RFL14363CF | Recombinant Full Length Candida Albicans Palmitoyltransferase Pfa3(Pfa3) Protein, His-Tagged | +Inquiry |
ELANE-7446H | Recombinant Human ELANE protein, His-tagged | +Inquiry |
MRPL49-6437HF | Recombinant Full Length Human MRPL49 Protein, GST-tagged | +Inquiry |
IFFO1-8001M | Recombinant Mouse IFFO1 Protein | +Inquiry |
CCPC-2509B | Recombinant Bacillus subtilis CCPC protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C7-102H | Active Native Human C7 Protein | +Inquiry |
F2-5285H | Native Human Coagulation Factor II (thrombin) | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
TRIM21-212B | Native Cow TRIM21 | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBTD2-542HCL | Recombinant Human UBTD2 293 Cell Lysate | +Inquiry |
UQCRC1-488HCL | Recombinant Human UQCRC1 293 Cell Lysate | +Inquiry |
FKRP-6199HCL | Recombinant Human FKRP 293 Cell Lysate | +Inquiry |
RGS3-2374HCL | Recombinant Human RGS3 293 Cell Lysate | +Inquiry |
TBX19-1203HCL | Recombinant Human TBX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket