Recombinant Full Length Neosartorya Fumigata Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL8844NF |
Product Overview : | Recombinant Full Length Neosartorya fumigata Formation of crista junctions protein 1(fcj1) Protein (Q4WP49) (42-624aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Neosartorya fumigata |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (42-624) |
Form : | Lyophilized powder |
AA Sequence : | ADAKPPVTGAPTPASPSSESSIPPETVPKPSPAAEAPLPPPPPPAPARKTGRFRKFLLYL ILTSGFAYGGGIFLALKSDNFHDFFTEYVPYGEDCVLYFEERDFYRRFPNTLRNQNRAPK DEGHTVTIPSKSGLSWKVAEEESGADVSQKGPHMSALDNGDKAQLKPGAAKPEEKVATVE KVKAESAAKEQTAEDKKKVKEEPKKPAAPAVTPIEFATVSEGDEEVVQELVKTFNDIITV IGADENAHKFSGAVNKAKEELRTIGEKIIAIRNEARKAAQEEIKQAHATFDESARELIRR FEEARAHDAAQYREEFEAERERLARAYQEKVNTELQRAQEVAEQRLKNELVEQAIELNRK YLHEVKDLVEREREGRLSKLNELTANVNLLEKLTTDWKEVIDTNLKTQQLQVAVDAVRSV LERSTVPRPFVRELVAVKELAAGDPVVEAAIASINPTAYQRGIPSTSQIIERFRRVADEV RKASLLPEDAGIASHAASLVLSKVMFKKDAVAGSDDVESVLLRTEHLLEEGNLDDAAREM NTLKGWAKILSKDWLSDVRRVLEVKQALEVRLGPFTSLFHLYR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mic60 |
Synonyms | mic60; AFUA_4G08030; MICOS complex subunit mic60; Mitofilin |
UniProt ID | Q4WP49 |
◆ Recombinant Proteins | ||
SGR-RS14055-905S | Recombinant Streptomyces griseus subsp. griseus NBRC 13350 SGR_RS14055 protein, His-tagged | +Inquiry |
VMAC-6183R | Recombinant Rat VMAC Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM19A1-884H | Active Recombinant Human FAM19A1 | +Inquiry |
RFL19915BF | Recombinant Full Length Barbarea Verna Atp Synthase Subunit B, Chloroplastic(Atpf) Protein, His-Tagged | +Inquiry |
YOD1-6633R | Recombinant Rat YOD1 Protein | +Inquiry |
◆ Native Proteins | ||
C4B-1846H | Native Human C4B Protein | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
F2-303R | Native Rat Thrombin | +Inquiry |
GCA-2H | Native Human Gastrointestinal Cancer Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
SSBP1-1465HCL | Recombinant Human SSBP1 293 Cell Lysate | +Inquiry |
JKAMP-5103HCL | Recombinant Human JKAMP 293 Cell Lysate | +Inquiry |
LPAR2-4674HCL | Recombinant Human LPAR2 293 Cell Lysate | +Inquiry |
ELAVL1-6637HCL | Recombinant Human ELAVL1 293 Cell Lysate | +Inquiry |
SEC61G-1989HCL | Recombinant Human SEC61G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mic60 Products
Required fields are marked with *
My Review for All mic60 Products
Required fields are marked with *
0
Inquiry Basket