Recombinant Full Length Kluyveromyces Lactis Formation Of Crista Junctions Protein 1(Fcj1) Protein, His-Tagged
Cat.No. : | RFL21902KF |
Product Overview : | Recombinant Full Length Kluyveromyces lactis Formation of crista junctions protein 1(FCJ1) Protein (Q6CSB8) (13-535aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Kluyveromyces lactis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (13-535) |
Form : | Lyophilized powder |
AA Sequence : | ASTNVPVKTARPFRNFLWKLGAATTVFYVGGVALSTYNYQFAELFTDNVPLAEELVQLVE SYNDGTLNAPQLSLDEIRKKFGSITRKVQSVPHLGSTSSTVTESQSIASGSGSTAAAATT GTDSNSVVLSSVPPVGSVLLRLPHLKLDDDSNSFNNKSFVESFNKQVDSLNEKEFILPEN AVESFLESYHGLSSQLNELNRDLADQLNSQLGQLSAELKQSVESDKVKEIESNKLQLMQQ FEKDLSNLKVEFEQKFDSQLQSSLKANEQAMLAKHKNELAMLSIKQVQEFNKIISNKIEN ERNGRLKNLDELNGSVKTVSDSLAALEETLLRSECVNQLTNLVSSIKFKLNLDNTPSLDI SKDLQKLTTLVNILPGKPNKCDAKEPQLIDVVVNELNSLTSAKENKQILSNEQLLNRWGL LQDKIREASLLPPNAGFLGHVSAKFFSLFLFNKSGISNENDIDSVISRVTENIKLNRLDK AVEDVVQLQGWSRLEADDWLQAARSKLELETLVDVVDHEIKTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MIC60 |
Synonyms | MIC60; KLLA0D02310g; MICOS complex subunit MIC60; Mitofilin |
UniProt ID | Q6CSB8 |
◆ Recombinant Proteins | ||
ABCA7-184M | Recombinant Mouse ABCA7 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL17A/F1-2922Z | Recombinant Zebrafish IL17A/F1 | +Inquiry |
EOMESA-9206Z | Recombinant Zebrafish EOMESA | +Inquiry |
SERPINB1-3966R | Recombinant Rhesus Macaque SERPINB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
METS-0851B | Recombinant Bacillus subtilis METS protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Liver-021H | Human Liver Lysate, Total Protein | +Inquiry |
Lectin-1848S | Active Native Soybean Agglutinin Protein | +Inquiry |
Lectin-1750M | Active Native Maackia Amurensis Lectin II Protein | +Inquiry |
LDL-403H | Native Human Low Density Lipoprotein, Oxidized, DiO labeled | +Inquiry |
CKB-46M | Native Mouse Creatine Kinase, Brain (CKB) Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADD2-9015HCL | Recombinant Human ADD2 293 Cell Lysate | +Inquiry |
KCNIP1-5056HCL | Recombinant Human KCNIP1 293 Cell Lysate | +Inquiry |
S100A16-2091HCL | Recombinant Human S100A16 293 Cell Lysate | +Inquiry |
FKBP2-6207HCL | Recombinant Human FKBP2 293 Cell Lysate | +Inquiry |
TECTB-661HCL | Recombinant Human TECTB lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MIC60 Products
Required fields are marked with *
My Review for All MIC60 Products
Required fields are marked with *
0
Inquiry Basket