Recombinant Full Length Rhizobium Sp. Uncharacterized Protein Y4Jf (Ngr_A03090) Protein, His-Tagged
Cat.No. : | RFL13802SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Uncharacterized protein y4jF (NGR_a03090) Protein (P55506) (1-519aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-519) |
Form : | Lyophilized powder |
AA Sequence : | MALANFIDRAATAASQVLTDFHLGDFKAALEKQVVAVAFDDQAASCAEGQATLDLAVRLL ARLYPVLAILPLDSASSFQAQALERLAKSINPKIGIRRSGKSAMVCLVAGATRPSLRCTT FFIGSDGWAAKLSRTDPVGSGSSLLPYGAGAASCFGAANVFRTIFAAQLTGAELDPDIDL SLYSYNKTKARDARPVDLPVDLGETHLVGLGAIGHGALWALARQSGLSGRLHVVDHEAVE LSNLQRYVLAGQAEIGMSKAVLATTALRSTALEVEAHPLKWAEHVARRGDWIFDRVGVAL DTAADRLAVQGALPRWIANAWTQEHDLGISRHGFDDGQACLCCMYMPSGKSKDEHQLIAE ELGIPETHEQVKALLQTNAGVPNDFVVRVATAMGVPFEPLAPFVGQPLRSFYQQAICGGL VFQLSDGSRLVRTVVPMAFQSALAGIMLAAELVKHSAGFPMSPTTSTRVNLLRPLGSHLH DPKAKDSSGRCICSDEDFISAYRRKYGNSVEPLSNISAT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NGR_a03090 |
Synonyms | NGR_a03090; y4jF; Uncharacterized protein y4jF |
UniProt ID | P55506 |
◆ Recombinant Proteins | ||
MED29-2544R | Recombinant Rhesus Macaque MED29 Protein, His (Fc)-Avi-tagged | +Inquiry |
ALOX5AP-309R | Recombinant Rhesus monkey ALOX5AP Protein, His-tagged | +Inquiry |
RFL23122TF | Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0878 (Tp_0878) Protein, His-Tagged | +Inquiry |
GRAP2-301176H | Recombinant Human GRAP2 protein, GST-tagged | +Inquiry |
HLA-B-8392H | Recombinant Human HLA-B protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
Lectin-1765D | Active Native Datura Stramonium Lectin Protein, Agarose bound | +Inquiry |
ANPEP-621H | Active Native Human ANPEP protein | +Inquiry |
AGP-001B | Native Bovine AGP Protein | +Inquiry |
HSV-2ag-268V | Active Native HSV-2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATP5H-8599HCL | Recombinant Human ATP5H 293 Cell Lysate | +Inquiry |
NADK2-8014HCL | Recombinant Human C5orf33 293 Cell Lysate | +Inquiry |
ST6GAL1-1760MCL | Recombinant Mouse ST6GAL1 cell lysate | +Inquiry |
PDF-3338HCL | Recombinant Human PDF 293 Cell Lysate | +Inquiry |
NKX2-8-1199HCL | Recombinant Human NKX2-8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NGR_a03090 Products
Required fields are marked with *
My Review for All NGR_a03090 Products
Required fields are marked with *
0
Inquiry Basket