Recombinant Full Length Treponema Pallidum Uncharacterized Protein Tp_0878 (Tp_0878) Protein, His-Tagged
Cat.No. : | RFL23122TF |
Product Overview : | Recombinant Full Length Treponema pallidum Uncharacterized protein TP_0878 (TP_0878) Protein (O83848) (1-316aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Treponema Pallidum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-316) |
Form : | Lyophilized powder |
AA Sequence : | MRSVDSRSSVTRWVCLTSVILFCFCIAVMRYGGVKKRRYFYGFCLHPRERADITEVILRF PREERNASRELRWVKKDRQWFIQLAHAIHPAKQEVLERLFQYLFTKRRFEFITNNTRFFS DYALGKQPAVQMKFTKKNGAAIGDIYFGALNGTGLGRYIRIGDNAAVFLTEDDFTPFFRD EKRFWCDTRQFHELFTQSQIQMMEVSGKYIVRSRTSVVFKEVEQFFARFSYVDVGPTPTQ WKESIVIHRGDGKIIRFRLQPAAHQEWTLWDAQSVHAYTLSAYTARYLFALISRMQTETG MSSLQQFDTEENLISD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TP_0878 |
Synonyms | TP_0878; Uncharacterized protein TP_0878 |
UniProt ID | O83848 |
◆ Recombinant Proteins | ||
WNT16-2359H | Recombinant Human WNT16 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARSB-383H | Recombinant Human ARSB Protein, His (Fc)-Avi-tagged | +Inquiry |
THAP5-761C | Recombinant Cynomolgus Monkey THAP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PPAPDC1B-1869H | Recombinant Human PPAPDC1B, His-tagged | +Inquiry |
NDUFA5-5090H | Recombinant Human NDUFA5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
M. pneumoniae-28 | Native Mycoplasma pneumoniae Antigen | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
Tryptase-01H | Active Native Human Tryptase Protein | +Inquiry |
C3-8092H | Native Human Plasma COMPLEMENT C (C3) | +Inquiry |
Lectin-1729G | Active Native Griffonia Simplicifolia Lectin I Protein, Rhodamine labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
LTA4H-731HCL | Recombinant Human LTA4H cell lysate | +Inquiry |
CRYZL1-7253HCL | Recombinant Human CRYZL1 293 Cell Lysate | +Inquiry |
C22orf39-8089HCL | Recombinant Human C22orf39 293 Cell Lysate | +Inquiry |
WDR46-345HCL | Recombinant Human WDR46 293 Cell Lysate | +Inquiry |
RNF181-1522HCL | Recombinant Human RNF181 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All TP_0878 Products
Required fields are marked with *
My Review for All TP_0878 Products
Required fields are marked with *
0
Inquiry Basket