Recombinant Full Length Rat Inward Rectifier Potassium Channel 4(Kcnj4) Protein, His-Tagged
Cat.No. : | RFL15642RF |
Product Overview : | Recombinant Full Length Rat Inward rectifier potassium channel 4(Kcnj4) Protein (P52190) (1-446aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-446) |
Form : | Lyophilized powder |
AA Sequence : | MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWCIAFFHGDLEPSPSGPTAGGPGGNGGGAAPTAAKPCIMHVNG FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMPRPKK RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEETGIIRMLEFG SHLDLERMQAATLPLDNISYRRESAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj4 |
Synonyms | Kcnj4; Irk3; Inward rectifier potassium channel 4; BIR11; Brain inwardly rectifying K(+ channel 2; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4 |
UniProt ID | P52190 |
◆ Recombinant Proteins | ||
RFL25329RF | Recombinant Full Length Rickettsia Bellii Lipoprotein Signal Peptidase(Lspa) Protein, His-Tagged | +Inquiry |
Gfra2-360M | Recombinant Mouse Gfra2 Protein, His-tagged | +Inquiry |
Abca9-8146R | Recombinant Rat Abca9 protein, His & T7-tagged | +Inquiry |
YWPJ-2184B | Recombinant Bacillus subtilis YWPJ protein, His-tagged | +Inquiry |
ANPEP-250H | Recombinant Human Aminopeptidase N(ANPEP) ,partial | +Inquiry |
◆ Native Proteins | ||
CELA3B-25P | Native Porcine Elastase Protein | +Inquiry |
MUC1-4770H | Active Native Human MUC1 Protein | +Inquiry |
Lectin-1743N | Active Native Narcissus Pseudonarcissus (Daffodil) Lectin Protein | +Inquiry |
GPX1-8429H | Native Human GPX1 | +Inquiry |
ARPC2-01P | Native Porcine ARPC2 Protein (Arp2/3 Protein Complex) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM58A-6363HCL | Recombinant Human FAM58A 293 Cell Lysate | +Inquiry |
NSUN2-3684HCL | Recombinant Human NSUN2 293 Cell Lysate | +Inquiry |
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
PPP1R36-8274HCL | Recombinant Human C14orf50 293 Cell Lysate | +Inquiry |
CD151-7684HCL | Recombinant Human CD151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnj4 Products
Required fields are marked with *
My Review for All Kcnj4 Products
Required fields are marked with *
0
Inquiry Basket