Recombinant Full Length Human Inward Rectifier Potassium Channel 4(Kcnj4) Protein, His-Tagged
Cat.No. : | RFL11301HF |
Product Overview : | Recombinant Full Length Human Inward rectifier potassium channel 4(KCNJ4) Protein (P48050) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MHGHSRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNG FLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKK RAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQR DLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMT TQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITV LPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFG SHLDLERMQASLPLDNISYRRESAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNJ4 |
Synonyms | KCNJ4; IRK3; Inward rectifier potassium channel 4; HIRK2; HRK1; Hippocampal inward rectifier; HIR; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4 |
UniProt ID | P48050 |
◆ Recombinant Proteins | ||
RFL4595SF | Recombinant Full Length Staphylococcus Aureus Na(+)/H(+) Antiporter Subunit B1 Protein, His-Tagged | +Inquiry |
BRINP3A-6406Z | Recombinant Zebrafish BRINP3A | +Inquiry |
RFL13630PF | Recombinant Full Length Pseudomonas Aeruginosa Putative Transporter Protein Amis(Amis) Protein, His-Tagged | +Inquiry |
EAF2-4940M | Recombinant Mouse EAF2 Protein | +Inquiry |
KCNJ8-2860R | Recombinant Rat KCNJ8 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
FABP3-42H | Native Human FABP3 | +Inquiry |
Cytochrome c-023H | Native Human Cytochrome c Protein | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
Total RNA-01E | Native E. coli Total RNA | +Inquiry |
Hemoglobin Glutamer-01B | Native Bovine Hemoglobin Glutamer | +Inquiry |
◆ Cell & Tissue Lysates | ||
Cervix-15H | Human Cervix Tissue Lysate | +Inquiry |
ACTR1A-9053HCL | Recombinant Human ACTR1A 293 Cell Lysate | +Inquiry |
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
C16orf78-1097HCL | Recombinant Human C16orf78 cell lysate | +Inquiry |
Skeletal Muscle-433H | Human Skeletal Muscle Membrane Diabetic Disease Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNJ4 Products
Required fields are marked with *
My Review for All KCNJ4 Products
Required fields are marked with *
0
Inquiry Basket