Recombinant Human KCNJ4 protein(231-310 aa), C-His-tagged

• Cat.No.: KCNJ4-2769H
• Product Overview: Recombinant Human KCNJ4 protein(P48050)(231-310 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 231-310 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: EGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLAS

Gene Information

• Gene Name: KCNJ4 potassium inwardly-rectifying channel, subfamily J, member 4 [ Homo sapiens ]
• Official Symbol: KCNJ4
• Synonyms: KCNJ4; potassium inwardly-rectifying channel, subfamily J, member 4; inward rectifier potassium channel 4; HIR; hIRK2; HRK1; IRK3; Kir2.3; inward rectifier K+ channel Kir2.3; inward rectifier K(+) channel Kir2.3; hippocampal inward rectifier potassium channel; potassium channel, inwardly rectifying subfamily J member 4; HIRK2; IRK-3; MGC142066; MGC142068
• Gene ID: 3761
• mRNA Refseq: NM_004981
• Protein Refseq: NP_004972
• MIM: 600504
• UniProt ID: P48050