Recombinant Full Length Mouse Inward Rectifier Potassium Channel 4(Kcnj4) Protein, His-Tagged
Cat.No. : | RFL22613MF |
Product Overview : | Recombinant Full Length Mouse Inward rectifier potassium channel 4(Kcnj4) Protein (P52189) (1-445aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-445) |
Form : | Lyophilized powder |
AA Sequence : | MHGHNRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMADIFTTCVDTRWRYMLM IFSAAFLVSWLFFGLLFWWIAFFHGDLEASPSVPAVGGPGGNGGESPNAPKPCIMHVNGF LGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVIDSFMIGTIMAKMARPKKR AQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPYMTQEGEYLPLDQRD LNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTT QARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYEVAGTPCCSARELQESKITVL PAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAGLGLEAGSKEEAGIIRMLEFGS HLDLERMQAATLPLDNISYRRESRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnj4 |
Synonyms | Kcnj4; Irk3; Inward rectifier potassium channel 4; Inward rectifier K(+ channel Kir2.3; IRK-3; Potassium channel, inwardly rectifying subfamily J member 4 |
UniProt ID | P52189 |
◆ Recombinant Proteins | ||
Arl9-1713M | Recombinant Mouse Arl9 Protein, Myc/DDK-tagged | +Inquiry |
NAE1-1281C | Recombinant Chicken NAE1 | +Inquiry |
BARX2-6458C | Recombinant Chicken BARX2 | +Inquiry |
LDB3A-11549Z | Recombinant Zebrafish LDB3A | +Inquiry |
PRL6A1-7113M | Recombinant Mouse PRL6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
F12-28805TH | Native Human F12 | +Inquiry |
Proteasome 20S-37H | Native Human Proteasome 20S Protein, Tag Free | +Inquiry |
ALPI-8348B | Native Bovine ALPI | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPL35-2201HCL | Recombinant Human RPL35 293 Cell Lysate | +Inquiry |
Lung-315R | Rat Lung Lysate | +Inquiry |
NOX5-3750HCL | Recombinant Human NOX5 293 Cell Lysate | +Inquiry |
PFKL-3272HCL | Recombinant Human PFKL 293 Cell Lysate | +Inquiry |
PC-3406HCL | Recombinant Human PC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnj4 Products
Required fields are marked with *
My Review for All Kcnj4 Products
Required fields are marked with *
0
Inquiry Basket