Recombinant Full Length Ralstonia Solanacearum Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL30285RF |
Product Overview : | Recombinant Full Length Ralstonia solanacearum Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8XXB6) (1-592aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ralstonia solanacearum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-592) |
Form : | Lyophilized powder |
AA Sequence : | MAVTSSSSSQPPAASQPGHFKRLWAYLRPELSSFILAMVAMGVVAATEGIIPKVVKDLLD QGFGGEYAGKLWRVPAMLVGIAVVRGVAQFGATYFLSLVSNKVLLNLRMKMFERLLQAPA AFYQRNTAASLINAVIFEVNQVLQVLTGVFITLVRDSMTVLALLIFLFYTNWRLTLVVAV ILPVIGFLMSRINRRLRSLNREHQNLTNEAAYVVEEAAGGYKVVKLHGGEAYESRRFNAM TNRLRGYAMRMAVAGGLNQPVTQFLAALALSVILAIAMVQAQANQTTVGGFTGFVMAMLL LISPLKHLTDVNQPMQRGLTAAEFIFGLIDTPIEPQDGGKHIDRARGDLRFEHVTFRYGP DGRAALDSIDLHVKAGEIVALVGPSGSGKTTLVNLLPRFFEPTSGRIVLDGDALADLSLQ DLRRQIAFVSQDVVLFNDTIAANVAYGARDASEIDMARVRRALEAAYLTDVVDNLPDGVD TNIGDNGSKLSGGQRQRLAIARAVYKDAPILILDEATSALDSESERQVQAALEALMQGRT TLVIAHRLSTIENADRIVVLEHGQIVEAGTHRELLDRDGLYAGLHRIQFATQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; RSc2200; RS01399; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8XXB6 |
◆ Recombinant Proteins | ||
Mep1a-609M | Active Recombinant Mouse Mep1a Protein, His-tagged | +Inquiry |
RFL15821PF | Recombinant Full Length Pan Paniscus Taste Receptor Type 2 Member 50(Tas2R50) Protein, His-Tagged | +Inquiry |
CLUL1-2083H | Recombinant Human CLUL1 Protein (Ala21-Ala442), C-His tagged | +Inquiry |
ARHGAP1-387R | Recombinant Rhesus monkey ARHGAP1 Protein, His-tagged | +Inquiry |
Anapc7-1623M | Recombinant Mouse Anapc7 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IGHG3-120H | Native Human Immunoglobulin G3 | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
Lectin-1812P | Active Native Peanut Lectin Protein, Agarose Bound | +Inquiry |
BGLAP-60H | Native Human BGLAP protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC16A1-1802HCL | Recombinant Human SLC16A1 293 Cell Lysate | +Inquiry |
Stomach-578M | MiniPig Stomach Lysate, Total Protein | +Inquiry |
CYB561D2-7147HCL | Recombinant Human CYB561D2 293 Cell Lysate | +Inquiry |
MAGEB6-4542HCL | Recombinant Human MAGEB6 293 Cell Lysate | +Inquiry |
ZNF266-2002HCL | Recombinant Human ZNF266 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket