Recombinant Full Length Burkholderia Thailandensis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL15356BF |
Product Overview : | Recombinant Full Length Burkholderia thailandensis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q2SZW0) (1-596aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Burkholderia thailandensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-596) |
Form : | Lyophilized powder |
AA Sequence : | MSVKPTLSKPIGGQDASSPAVVMRRLWPYVKPLVWVLVAGVLAMAAVAATEAGIPALLKP LLDHGFGSKGDMTTKLYVPAAVVGLALARAIAQYASGYLLQYVSNRILLDLRIQMFERMI HTGVSFFQRETASTVINAVVFEVNQVLSVLMGVMITLVRDSLTVVFLLGYLFYLNWRLTL IVAILLPCIGWLVGKINRRLRRLNREHQTLTNQLAYIVEETVGGYKVVKVHNGESYEIGR FNELSRKLRGYSMRMTVSGGLAQPLTQFLASIALAVVLTIAVVQSSNDQTTVGGFVAFVT AMLLIISPLKHLMDVNQPLQRGMTAAELIFGLIDEPREPEGGGKPLARASGAIEFSHVSF SYGISRDGRQTLDDVSFTVAPGEMVALAGPSGSGKTTLVNLLPRFFDPSSGTVRVDGVAL PEYSLHDLRNQIAMVSQDVVLFNDTIAANVAYGQTPERDGVEAALRAANLWETVTAMPDG IDTLVGDNGMRLSGGQRQRLAIARAIYKDAPILILDEATSALDSESERHVQAALETLMKG RTTLVIAHRLSTIERADRILVLEGGKIVESGSHRELLEQGGLYAHLHRIQFQQDAG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; BTH_I0985; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q2SZW0 |
◆ Recombinant Proteins | ||
Serpinc1-541M | Recombinant Mouse Serpinc1 Protein, His-tagged | +Inquiry |
PROS1-206HFL | Recombinant Full Length Human PROS1 Protein, C-Flag-tagged | +Inquiry |
DCAF5-1013R | Recombinant Rhesus Macaque DCAF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD274-593H | Recombinant Human CD274 Protein | +Inquiry |
Met-4062MF | Recombinant Mouse Met Protein, His-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
RBP4-247H | Native Human Retinol Binding Protein 4 | +Inquiry |
GG-190H | Native Horse Gamma Globulin protein | +Inquiry |
Hemoglobin F-034H | Native Human Hemoglobin F Protein | +Inquiry |
alpha Thrombin native protein-3287H | Native Human alpha Thrombin | +Inquiry |
KLKB1-211S | Active Native Porcine Kallikrein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNNT3-878HCL | Recombinant Human TNNT3 293 Cell Lysate | +Inquiry |
EDEM2-862HCL | Recombinant Human EDEM2 cell lysate | +Inquiry |
EDA2R-2021HCL | Recombinant Human EDA2R cell lysate | +Inquiry |
HIST1H2AK-325HCL | Recombinant Human HIST1H2AK lysate | +Inquiry |
TH-485MCL | Recombinant Mouse TH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket