Recombinant Full Length Pseudomonas Syringae Pv. Tomato Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL17771PF |
Product Overview : | Recombinant Full Length Pseudomonas syringae pv. tomato Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q87VF3) (1-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Syringae Pv. Tomato |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-600) |
Form : | Lyophilized powder |
AA Sequence : | MTTPESSATSSVKIYFRLLSYVRPYVGIFLLSILGFVIFASTQPMLAGILKYFVDGLSNP EAVLFPNVPYLRELQLLQAVPLLIVLIAAWQGLGSFLGNYFLAKVSLGLVHDLRVELFNK LLVLPNRYFDTTNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFIYLLMMNWKL TLVMLAILPLIAVMVSSASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEAYEQ NRFAEASDSNTRKQLRMTKTGAIYTPMLQLVIYSAMAVLMFLVLFLRGDATAGDLVAYIT AAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEEEVDTGTIELDRVSGHLEVKNLSF FYPQTERQVLNDISFSAAPGQMIALVGRSGSGKSTLANLIPRFYGHEMGNILLDGVEIND YRLRNLRKHIAQVNQNVTLFNDSIANNIAYGDLAGAPRADIEAAAADAYAKEFIDQLPQG FDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVMKG RTTLVIAHRLSTIEKADMILVMDAGKIVERGTHTELLAQNGYYARLHAMGLDEPAPAGAV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PSPTO_4984; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q87VF3 |
◆ Recombinant Proteins | ||
EGR4-3126H | Recombinant Human EGR4 Protein, GST-tagged | +Inquiry |
IFNA1-1648H | Recombinant Human IFNA1 Protein, His&GST-tagged | +Inquiry |
UBE2H-1959H | Recombinant Human Ubiquitin-Conjugating Enzyme E2H, His-tagged | +Inquiry |
NR4A2-2451H | Recombinant Human NR4A2 Protein (1-598 aa), His-tagged | +Inquiry |
Prdx1-8047M | Recombinant Mouse Prdx1 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1822P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Agarose bound | +Inquiry |
E2-01H | Native Human Estradiol (E2) | +Inquiry |
Mucin-232P | Native Porcine Mucin | +Inquiry |
Hp-194R | Native Rat Haptoglobin | +Inquiry |
Myosin S1-879R | Native Rabbit Myosin S1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF572-47HCL | Recombinant Human ZNF572 293 Cell Lysate | +Inquiry |
SLCO1B3-1688HCL | Recombinant Human SLCO1B3 293 Cell Lysate | +Inquiry |
APLP2-92HCL | Recombinant Human APLP2 cell lysate | +Inquiry |
F7-1973HCL | Recombinant Human F7 cell lysate | +Inquiry |
ZNF83-2092HCL | Recombinant Human ZNF83 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket