Recombinant Full Length Pseudoalteromonas Atlantica Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL32423PF |
Product Overview : | Recombinant Full Length Pseudoalteromonas atlantica Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q15UY7) (1-585aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudoalteromonas atlantica |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-585) |
Form : | Lyophilized powder |
AA Sequence : | MTHTLPTQNVFKRFAVYLKDFKLAFGVAIIGMVGYSLIDAYVISLLQPIIDGNGGKWDYD YLRIAAYFVIPVFIARGIFNFMGTYTLSWISSQVVMKMREQLFHQYMHLPVEFHDHHPSG QLISKVIYDTEQVAGAAGKAFLTLVREGALVFGLLFWMFYHSWQLSLVFILIGPLVAMIV SVVSKRFRLVSKNIQQAMGNLTSSAEQIIKGHKVVLMFGGQDLEASRFAKKNNNNRQQNM KLVIAQILSVSSIQVIASVALAVVLYISSKPNFITDLTPGTFVTVVVAMTMLLKPLKQLT TVNSEFQKGMAACVSIFSVLDNAIEKDTGSKVLDKAKGKLEFRDVTFHYPNKEEAALSDM SFTVEPGKTFALVGRSGSGKSTISSLLTRFYDAQQGTILLDDVPLQDFKLKDLRRQFALV SQHVTLFNDTIANNIAYGSEGRVTPEQVLAAAKTAHALEFIEQLPNGMETLIGENGLMLS GGQRQRLAIARAVLLDAPVLILDEATSALDTESERLIQDALETLQQDRTSIVVAHRLSTI ESADQILVIERGRILEQGDHASLLSEDGAYAQLHKLQFGDGQTDA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Patl_1780; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q15UY7 |
◆ Native Proteins | ||
IgD-213H | Native Human Immunoglobulin D (IgD) | +Inquiry |
Lectin-1753A | Active Native Aleuria Aurantia Lectin Protein, Fluorescein labeled | +Inquiry |
CAPN1-27397TH | Active Native Human Calpain-1 | +Inquiry |
Spleen-006H | Human Spleen Lysate, Total Protein | +Inquiry |
Lectin-1777G | Active Native Galanthus Nivalis Lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP3K13-1055HCL | Recombinant Human MAP3K13 cell lysate | +Inquiry |
DERL1-6971HCL | Recombinant Human DERL1 293 Cell Lysate | +Inquiry |
EIF4EBP1-6649HCL | Recombinant Human EIF4EBP1 293 Cell Lysate | +Inquiry |
PDK2-3329HCL | Recombinant Human PDK2 293 Cell Lysate | +Inquiry |
MMP13-4280HCL | Recombinant Human MMP13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket