Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL35060XF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5H0H0) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xanthomonas oryzae pv. oryzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MTNSTDRPVSVSSWRTYRRLVAFAKPYRLLLVAALIAALIEAAGTTGFLALMKPITDETF IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRIKVMAKYLRLPGSRF DSEPVPSMLIRLGSDSDQVAQAAVDAIKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAVALTRAKGLIEFRDVTARYPGQVN PALADVSFIAQPGTVTAIVGRSGSGKSSLIKLIPRFYDAEAGQILLDGQPVQAYALADLR RQIALVGQQVMLFDGSIAENVAFGEMRSADASQLERAILGANAMEFVAQLPEGLQSHVGA KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA HRLSTIEHADQVLVMDQGRIVERGTHHELLAQGGLYSHLHGMQFRERQA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; XOO2297; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5H0H0 |
◆ Recombinant Proteins | ||
EEF2KMT-4230H | Recombinant Human EEF2KMT protein, His-tagged | +Inquiry |
Nr2e3-4490M | Recombinant Mouse Nr2e3 Protein, Myc/DDK-tagged | +Inquiry |
CYPA-1399B | Recombinant Bacillus subtilis CYPA protein, His-tagged | +Inquiry |
RFL23412BF | Recombinant Full Length Bovine Claudin-15(Cldn15) Protein, His-Tagged | +Inquiry |
SPOP-527HFL | Active Recombinant Full Length Human SPOP Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-129B | Native Bovine milk Immunoglobulin G | +Inquiry |
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
HbA0-9382H | Native Human Hemoglobin A0, Ferrous Stabilized | +Inquiry |
Tf-264R | Native Rat Transferrin | +Inquiry |
Gliadin-168W | Native Wheat Gliadin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PTBP1-2728HCL | Recombinant Human PTBP1 293 Cell Lysate | +Inquiry |
WDTC1-325HCL | Recombinant Human WDTC1 293 Cell Lysate | +Inquiry |
KLRB1-4896HCL | Recombinant Human KLRB1 293 Cell Lysate | +Inquiry |
TSR2-697HCL | Recombinant Human TSR2 293 Cell Lysate | +Inquiry |
ARMC2-125HCL | Recombinant Human ARMC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket