Recombinant Full Length Legionella Pneumophila Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL26939LF |
Product Overview : | Recombinant Full Length Legionella pneumophila Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5WVN2) (1-588aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Legionella Pneumophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-588) |
Form : | Lyophilized powder |
AA Sequence : | MKNNLPIKSRLLYKRLLSYVKPFWPVLLLGVLANILYSGIDAGFTYMTKLFLDKSFITID LDFVKQIPLIVLIGITLRGLVSSLGSYCMTWVARSVVKVLRQTVFSHIIHLPADYYDEAT SGQLLSKILYDVEQVAQVSADALTDFIQNICLVIGLLTVMMVICWQLSLMFLLTIPFVGI IVNYTNKRVRRISHKVQKTMGEVTEIASEAIEGYRVVRIFGGERYEITKFNKATEYSRKN DMKVAISKAINVSGVQLVIAIGIAMIIMAAIHLSTVITISAGSFLAIIAAMLQLIKPMKT LTTLNATIQRGLAGAESVFNLLDLPLERNNGLILKDKIRGEIEFKHVYHAYRQGQNILHD VNFVIEAGTSVALVGHSGSGKTTIASLLPRFYELSQGMITLDGMPIQQLSLESLRKQMSL VSQNVTLFNDTLANNIAYGRFDASREQIITAAKLAYADEFIKQLPDGYDTRVGENGVLLS GGQRQRIAIARAILKDAPILILDEATSALDSESEHYIQAALEQVMNGRTTLIIAHRLSTI KHAHKIIVMQHGRIVEQGSHQELLDMDGHYAQLYKVQQFGRVNEEVVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; lpl1783; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5WVN2 |
◆ Recombinant Proteins | ||
RFL8453OF | Recombinant Full Length Oryza Nivara Photosystem Ii Reaction Center Protein H(Psbh) Protein, His-Tagged | +Inquiry |
FGF6-040H | Active Recombinant Human FGF6 Protein | +Inquiry |
ZDHHC12-6659R | Recombinant Rat ZDHHC12 Protein | +Inquiry |
CD46-1463M | Recombinant Mouse CD46 Protein, His (Fc)-Avi-tagged | +Inquiry |
MPXV-0220 | Recombinant Monkeypox Virus B14R Protein | +Inquiry |
◆ Native Proteins | ||
Prethrombin-2-294M | Native Mouse Prethrombin-2 | +Inquiry |
CAT-1187B | Native Bovine Catalase | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
Hb-901M | Native Mouse Hemoglobin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMA7-7750HCL | Recombinant Human CCDC72 293 Cell Lysate | +Inquiry |
HMGCR-802HCL | Recombinant Human HMGCR cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
LDHAL6A-978HCL | Recombinant Human LDHAL6A cell lysate | +Inquiry |
ANKFY1-77HCL | Recombinant Human ANKFY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket