Recombinant Full Length Psychrobacter Cryohalolentis Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL21259PF |
Product Overview : | Recombinant Full Length Psychrobacter cryohalolentis Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q1QBW0) (1-598aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Psychrobacter cryohalolentis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-598) |
Form : | Lyophilized powder |
AA Sequence : | MSQAYQPDSTKTSAKTPVAPTVATLNPPKRKTLMRLLAYLKPYWWAILLTIIGFAINAAT EIWIAKLLQYITDAINQNDQSKQDLFPFIIVMLFFVRGVGSFLGNYYTALVSRNLVYELR VEVFNKLLRLPSSFYLANPAGTISSKLIFDVEQVTAASTDSMKTLLRDGLTVVALMGFLL YSNWRLTLILFVVLPPILWLIRVASKRYLKLSKGIQETMGDVSHITNEVINGYQVVKNYG GQVYESKRFDVTSKKNLRQGMKVVVTNSINTPAVQLLMAMAMAVVVWLALRPAVIDDISA GQFISYIAAAGLLSKPVRSLTDVNQQLQRGLAAGESIFALLDEPEEADTGVLSPTLAGEI KLDNVSLVYPDSTVALHDFNLDIRAGETVALVGRSGAGKSSLVNLLTRTLTTSSGQITLD GMPIEDIKLESLRAQIAMVNQQVVLFNTTVFNNIAYGSLAHKTPAEVEQAAKDAFAHDFI MQMPNGYQSEIGAEGLQLSGGQRQRLSIARALLKDAPILILDEATSALDNESEYYIQKAL DNIMKNRTTLVIAHRLTTIESADRIAVLDGGQIVELGTHTQLMQLHGHYAQMYARDFE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Pcryo_1062; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q1QBW0 |
◆ Recombinant Proteins | ||
ASCC1-2303H | Recombinant Human ASCC1, His-tagged | +Inquiry |
ACVR1B-2614H | Active Recombinant Human ACVR1B protein, hFc&His-tagged | +Inquiry |
EDN2-4192HF | Recombinant Full Length Human EDN2 Protein, GST-tagged | +Inquiry |
UCHL3-2748H | Recombinant Human UCHL3 protein, His-tagged | +Inquiry |
SEMA4C-8007M | Recombinant Mouse SEMA4C Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Testosterone-01H | Native Human Testosterone | +Inquiry |
Acid phosphatase-158 | Active Native Wheat Germ Acid phosphatase Protein | +Inquiry |
KLK1-29685TH | Native Human KLK1 | +Inquiry |
IgG1-227H | Native Human Immunoglobulin G1 (IgG1) | +Inquiry |
HBsAg-01 | Native Hepatitis B Surface Ag protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
USP54-729HCL | Recombinant Human USP54 lysate | +Inquiry |
CD5L-3042MCL | Recombinant Mouse CD5L cell lysate | +Inquiry |
DTL-6801HCL | Recombinant Human DTL 293 Cell Lysate | +Inquiry |
S100A16-2091HCL | Recombinant Human S100A16 293 Cell Lysate | +Inquiry |
EIF4A2-6653HCL | Recombinant Human EIF4A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket