Recombinant Full Length Desulfotalea Psychrophila Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL15243DF |
Product Overview : | Recombinant Full Length Desulfotalea psychrophila Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q6AJW3) (1-572aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Desulfotalea psychrophila |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-572) |
Form : | Lyophilized powder |
AA Sequence : | MTNKEIIKRLYHEIIPYKIPLFIAMFAMIVVAALTGAQAYLVKDLLDKIFMEKDVFFLQI LPLIIIAIFFTKGVLYYTYAIILERVGQSIIRDFRLKIFAHIHRQSLSFFHNTPTGTLIS RVLSDVALMQQAVSTVIIQLLRDFFQVIFLLGVIFYMNWKLALICFLIIPLAAIPIVKFG KIFRKLSTKTQEETAEVSNMLHETISGSRIVKAFCREDYEVERFHRQVETLFTITMKNAK YRVFQSPLMEIIGGFAVAGIIWVGGSEVINGSATPGTFFAFLTAMITAYDPVKRVSQVNS TIQQGLASAQRVFAILDIKPEIEDKPEATSLAPFKESIEFHDVSFSYGTEKILSHINLKV PAGEALAIVGPSGGGKTTLTNLIPRFIDLQEGSITIDGTDIRDVTTNSLRNQIAMVTQQT ILFNDTIRNNIAYGKDSCTEEEIRRAAKAAHALTFIEELPNGFDTALGEGGAKLSGGQRQ RISIARALLADAPILILDEATSALDTESEREVQKALENLMQNRTTFVIAHRLSTIKNASR IVVVKKGKIVEEGSHEELLKLEGEYQLLYNMQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; DP2634; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q6AJW3 |
◆ Recombinant Proteins | ||
ITM2B-65M | Recombinant Mouse ITM2B Protein, His-tagged | +Inquiry |
KCNMB2-3216R | Recombinant Rat KCNMB2 Protein | +Inquiry |
CECR2-3857C | Recombinant Chicken CECR2 | +Inquiry |
FOXQ1-6014M | Recombinant Mouse FOXQ1 Protein | +Inquiry |
BID-218H | Recombinant Human BID Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100BB-10H | Native Human S100BB | +Inquiry |
GPT-26879TH | Native Human GPT | +Inquiry |
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
Pepsin-27H | Native Human Pepsin (PP) Protein | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCSAML-8179HCL | Recombinant Human C1orf150 293 Cell Lysate | +Inquiry |
ENTPD2-001HCL | Recombinant Human ENTPD2 cell lysate | +Inquiry |
DEPDC6-6973HCL | Recombinant Human DEPDC6 293 Cell Lysate | +Inquiry |
TUBA3C-659HCL | Recombinant Human TUBA3C 293 Cell Lysate | +Inquiry |
B3GNT6-001HCL | Recombinant Human B3GNT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket