Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL96EF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q8FJB1) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGVALILNAASDTFMLSLLKPLLDDGFGKTD RSVLMWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSI AIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFTILDSEQEKDEGKRVIERATGDVEFRNVTFTYPGRDVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGEILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEQYSREQIEEAARMAYAMDFINKMDNGLDTVIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEKADEIVVVEDGVIVERGTHNDLLEHRGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; c1054; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q8FJB1 |
◆ Recombinant Proteins | ||
MXD1-2778M | Recombinant Mouse MXD1 Protein (1-227 aa), His-Myc-tagged | +Inquiry |
PDGFA-1044C | Active Recombinant Canine PDGFA protein(Ser87-Arg196), hFc-tagged | +Inquiry |
Csf3-048M | Recombinant Mouse Csf3 Protein, MYC/DDK-tagged | +Inquiry |
ING5-2270R | Recombinant Rhesus monkey ING5 Protein, His-tagged | +Inquiry |
RDH12-3655R | Recombinant Rhesus Macaque RDH12 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Compound E-12 | Compound E, Antibotics Free | +Inquiry |
CGA-8162H | Native Human Pregnancy Chorionic Gonadotropin | +Inquiry |
LLC-231H | Native Human Lambda Light Chain | +Inquiry |
CKM-368P | Native Pig Creatine Kinase, Muscle | +Inquiry |
Placenta-020H | Human Placenta Lysate, Total Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM19A4-001HCL | Recombinant Human FAM19A4 cell lysate | +Inquiry |
Fetal Heart-143H | Human Fetal Heart Membrane Lysate | +Inquiry |
PAK3-517HCL | Recombinant Human PAK3 cell lysate | +Inquiry |
DAAM2-214HCL | Recombinant Human DAAM2 lysate | +Inquiry |
CENPQ-7576HCL | Recombinant Human CENPQ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket