Recombinant Full Length Xylella Fastidiosa Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL10791XF |
Product Overview : | Recombinant Full Length Xylella fastidiosa Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q87EF0) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xylella fastidiosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MNVLSGAMRYATPWRTYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALMKPITNETF IERNREVALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTKYFRLPGSRF DGEPVASMLVRLGSDSEQVAHAVIDAMKVMVQQTLQVIGALVVMLWYSWTVTLAILLVAP LLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAAQESELERYARLANI NLGLAVKVESTRSISSAAVQLLGAVGLAMLLLIAGHEALAGRLSPGDFVSLMTSMIAVIP ALKQLTNVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGRARGLIEFRGITARYPGRSA PVLDSVSFVAAPGTVTAIVGRSGSGKSSLIKLIPRFYEPESGQILLDGHPLQDYLLADLR RQIALVGQQVMLFDGSIADNIAYGEMRQVVSEEIERVVVDANAQDFVNQLPEGLQFQVGV KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALQRLMPERTTLVIA HRLSTIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQFRERPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PD_0361; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q87EF0 |
◆ Recombinant Proteins | ||
RFL25731PF | Recombinant Full Length Pan Troglodytes Palmitoyltransferase Zdhhc5(Zdhhc5) Protein, His-Tagged | +Inquiry |
LGMN-68H | Recombinant Human LGMN protein, His-tagged | +Inquiry |
CASP2-0858H | Recombinant Human CASP2 Protein (Gly334-Thr452), His tagged | +Inquiry |
PGO1-P02-4001S | Recombinant Staphylococcus aureus PGO1_P02 protein, His-tagged | +Inquiry |
ARHGEF18-783H | Recombinant Human ARHGEF18 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
S100A1B-9H | Native Human S100A1B | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
FABP-173C | Native Canine Fatty acid Binding Protein | +Inquiry |
LTF-8196H | Native Human Breast Milk Lactoferrin APO | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
RANBP6-1468HCL | Recombinant Human RANBP6 cell lysate | +Inquiry |
CENPB-333HCL | Recombinant Human CENPB cell lysate | +Inquiry |
ZNF428-73HCL | Recombinant Human ZNF428 293 Cell Lysate | +Inquiry |
TXNIP-620HCL | Recombinant Human TXNIP 293 Cell Lysate | +Inquiry |
Cecum-62C | Cynomolgus monkey Cecum Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket