Recombinant Full Length Pseudomonas Aeruginosa Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL10784PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q9HUG8) (1-603aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-603) |
Form : | Lyophilized powder |
AA Sequence : | MSDSPQNPGPSSLKIYFRLLGYVKPYIGMFLLSIVGFLIFASTQPMLAGILKYFVDGLSN PDAALFPNVQWPWLRDLHLVYAVPLLIILIAAWQGLGSFLGNFFLAKVSLGLVHDLRVAL FNKLLVLPNRYFDTHSSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFLYLLWMN WKLTLVMLAILPVIAVMVTTASRKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEA YEEKRFLDASQSNTDKQLRMTKTGAVYTPMLQLVIYVAMAILMFLVLWLRGDASAGDLVA YITAAGLLPKPIRQLSEVSSTVQRGVAGAESIFEQLDEAAEEDQGTVEKERVSGRLEVRN LSFRYPGTDKQVLDDISFIAEPGQMIALVGRSGSGKSTLANLVPRFYQHNDGKILLDGVE VEDYRLRNLRRHIALVTQQVTLFNDSVANNIAYGDLAGAPREEIERAAKAANAKEFIDNL PQGFDTEVGENGVLLSGGQRQRLAIARALLKDAPLLILDEATSALDTESERHIQAALDEV MKGRTTLVIAHRLSTIEKADLILVMDQGQIVERGSHAELLAQNGHYARLHAMGLDEQAPA PVG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PA4997; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q9HUG8 |
◆ Recombinant Proteins | ||
MRPL23-3768R | Recombinant Rat MRPL23 Protein | +Inquiry |
WDR18-1392Z | Recombinant Zebrafish WDR18 | +Inquiry |
HGF-210H | Recombinant Human HGF protein, Fc-tagged | +Inquiry |
METTL18-4407H | Recombinant Human METTL18 Protein, GST-tagged | +Inquiry |
BRAF-26567TH | Recombinant Human BRAF | +Inquiry |
◆ Native Proteins | ||
LOC780933-1B | Native Bovine Anhydrotrypsin | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
Trypsin-251H | Active Native Human Trypsin | +Inquiry |
Collagen-322H | Native Human Collagen IV | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCF4-3949HCL | Recombinant Human NCF4 293 Cell Lysate | +Inquiry |
KIAA0247-4979HCL | Recombinant Human KIAA0247 293 Cell Lysate | +Inquiry |
TEC-1153HCL | Recombinant Human TEC 293 Cell Lysate | +Inquiry |
LARS2-972HCL | Recombinant Human LARS2 cell lysate | +Inquiry |
FCGR1-1987MCL | Recombinant Mouse FCGR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket