Recombinant Full Length Salmonella Typhimurium Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL18273SF |
Product Overview : | Recombinant Full Length Salmonella typhimurium Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (P63359) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Salmonella typhimurium |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MHNDKDLSTWQTFRRLWPTIAPFKAGLIVAGIALILNAASDTFMLSLLKPLLDDGFGKTD RSVLLWMPLVVIGLMILRGITSYISSYCISWVSGKVVMTMRRRLFGHMMGMPVAFFDKQS TGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILVVLAPIVSI AIRVVSKRFRSISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNKMRLQ GMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKS LTNVNAQFQRGMAACQTLFAILDSEQEKDEGKRVIDRATGDLEFRNVTFTYPGREVPALR NINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVA LVSQNVHLFNDTVANNIAYARTEEYSREQIEEAARMAYAMDFINKMDNGLDTIIGENGVL LSGGQRQRIAIARALLRDSPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLS TIEQADEIVVVEDGIIVERGTHSELLAQHGVYAQLHKMQFGQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; STM0984; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | P63359 |
◆ Recombinant Proteins | ||
ZBTB39-5260R | Recombinant Rhesus monkey ZBTB39 Protein, His-tagged | +Inquiry |
USP3-2633H | Recombinant Human USP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ALG11-7488Z | Recombinant Zebrafish ALG11 | +Inquiry |
RCBTB1-7495M | Recombinant Mouse RCBTB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MOMP-1260C | Recombinant Chlamydia psittaci MOMP Protein (Leu23-Phe391), N-His tagged | +Inquiry |
◆ Native Proteins | ||
F13A1-1881H | Native Human Coagulation Factor XIII, A1 Polypeptide | +Inquiry |
Lectin-1726W | Native Wheat Germ Lectin, FITC conjugated | +Inquiry |
TSH-1315B | Active Native Bovine TSH Protein | +Inquiry |
Collagen Type Ⅱ-525B | Native Bovine Type Collagen Type Ⅱ Protein | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
◆ Cell & Tissue Lysates | ||
MT1F-4102HCL | Recombinant Human MT1F 293 Cell Lysate | +Inquiry |
Thyroid-627R | Rat Thyroid Lysate, Total Protein | +Inquiry |
SMOX-1656HCL | Recombinant Human SMOX 293 Cell Lysate | +Inquiry |
DEAF1-461HCL | Recombinant Human DEAF1 cell lysate | +Inquiry |
C2orf88-8058HCL | Recombinant Human C2orf88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket