Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL32620XF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q9PEE7) (1-589aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xylella fastidiosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-589) |
Form : | Lyophilized powder |
AA Sequence : | MNVLSGAMRYATPWRTYRRLLSYAREYRWLLVVAACGALLEAVAGSTFLALMKPITNETF IERNREVALWLPLGIVGLFLLRGIAGYITDMAMGRAARSIARDFRVCVLTKYFRLPGSRF DGEPVASMLVRLGSDSEQVAHAVIDAMKVMVQQTLQVIGALVVMLWYSWTVTLAILLVAP LLAWVMQRVAKRYRRISHHIQESNAQLMQAADQALSNYQDVKVYAAQESELERYARLANI NLGLAIKVESTRSLSSAAVQLLGAVGLAMLLLIAGHEALAGRLSPGDFVSLMTSMIAVIP ALKQLTNVQNMLQSGIASAQRLFSVLDSPDELDTGRRPLGRARGFIEFRGITARYPGRSA PVLDSVSFVAAPGTVTAIVGRSGSGKSSLIKLIPRFYEPESGQILLDGHPLQDYLLADLR RQIALVGQQVMLFDGSIAENIAYGEMRQVVSEEIERVVVDANAQDFVNQLPEGLQFQVGV KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALQRLMPERTTLVIA HRLSTIKHADQVLVMDQGRIIESGTHVDLLARDGLYAYLYSMQFRERPT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; XF_1081; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q9PEE7 |
◆ Native Proteins | ||
Immunoglobulin G1-81H | Native Human Immunoglobulin G1 | +Inquiry |
PTGS1-141S | Native Sheep PTGS1 Protein | +Inquiry |
HB-43R | Native Rat Hemoglobin (HB) Protein | +Inquiry |
AZU1-26565TH | Native Human AZU1 | +Inquiry |
TF-261M | Native Monkey Transferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD40-1254CCL | Recombinant Cynomolgus CD40 cell lysate | +Inquiry |
MRPL4-4171HCL | Recombinant Human MRPL4 293 Cell Lysate | +Inquiry |
C1orf94-8144HCL | Recombinant Human C1orf94 293 Cell Lysate | +Inquiry |
DNM3-6856HCL | Recombinant Human DNM3 293 Cell Lysate | +Inquiry |
Cerebrum-87M | Mouse Cerebrum Tissue Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket