Recombinant Full Length Vibrio Fischeri Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL21927VF |
Product Overview : | Recombinant Full Length Vibrio fischeri Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q5E0F2) (1-582aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Vibrio fischeri |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-582) |
Form : | Lyophilized powder |
AA Sequence : | MTIEKDESTWATFKRLWPHISLYKAGLGVAVVALVINALSDTYMISLLKPLLDEGFGSAD SDFLKKMPFIILAMMFIRGLSGFVSGYCMSWVASNVVMRIRRQIFNHFMHMPVSYFDQES TGRLLSRITYDSEQVAAATSKALVNIVRESASIIGLLGLMFWNSWQLSLVLVVIAPVVAF AISNVSKRFRKISKNMQTAMGSLTATSEQMLKGHKVVLSYGGQKVESERFDNISNHMRQQ NMKMVVAQGLANPIIQMIASFALVTVLYLASVDSIKETLTPGTFTVVFSAMFGLLRPLKG LTSVTSDFQRGMAACQTLFELMDMDKEKDDGTIEKDTVKGDIKVDNVTFTYPTADGPALR NVSFDLPAGKTIALVGRSGSGKSTIANLFTRFYDVDSGEISLDGDKIEDYRLPNLRKHFA LVSQNVHLFNDTVANNIAYASEGKFTRLEIEKAAELAYASDFINKMDDGFDTMIGENGAS LSGGQRQRIAIARALLQNAPVLILDEATSALDTESEKAIQSALDELQKDKTVLVIAHRLS TIEDADQILVVDEGEVVERGNHAELIAHDGAYAQLHRIQFGD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; VF_A0424; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q5E0F2 |
◆ Recombinant Proteins | ||
EDDM3A-4503HF | Recombinant Full Length Human EDDM3A Protein, GST-tagged | +Inquiry |
RAE1-584C | Recombinant Cynomolgus Monkey RAE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PRAP1-175H | Recombinant Human PRAP1, His-tagged | +Inquiry |
GLPD-880E | Recombinant Escherichia coli GLPD Protein (1-501 aa), His-tagged | +Inquiry |
TAT-4766Z | Recombinant Zebrafish TAT | +Inquiry |
◆ Native Proteins | ||
TPSAB1-02H | Active Native Human TPSAB1 Protein | +Inquiry |
HB-01H | Native Human HB Protein | +Inquiry |
IgA-7430M | Active Native Mouse IgA Kappa Protein | +Inquiry |
MMP8-1656H | Active Native Human MMP8 Protein | +Inquiry |
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LDHD-979HCL | Recombinant Human LDHD cell lysate | +Inquiry |
MOCS2-4261HCL | Recombinant Human MOCS2 293 Cell Lysate | +Inquiry |
FAM71C-6355HCL | Recombinant Human FAM71C 293 Cell Lysate | +Inquiry |
DRG1-6815HCL | Recombinant Human DRG1 293 Cell Lysate | +Inquiry |
TRNT1-749HCL | Recombinant Human TRNT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket