Recombinant Full Length Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL32782FF |
Product Overview : | Recombinant Full Length Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q47908) (1-593aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Francisella novicida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-593) |
Form : | Lyophilized powder |
AA Sequence : | MTNHQKVGTLYKRLLLQVKHLMAFSAFGCYRKYIFLSADASMIYLINPILNYGFGPGGGI TKQSATILMLMGVGMVGFIALRSVGSFVSQYFIGSLGQKVVYKFRKDIYKRLMDLPASFF DKHSTGQIISRLLYNVDQVTEATSTAIITVVQDGTFVIGLIVVMFVSSWQLSLFLIVVGP FLGLFISIINKKFRNLSRNTQSSMGNVTHTAEETIRNYKEIRIFGAQQKQQNKFFKNLDY TYSQQIRTIALDALTSPVIQIIASLVLAFSLFTIAIFGTNDGGGSSWLTAGSFASFFAAA AAILKPIKNLTKVNVVIQKAVAATEDIFYILDYPAEKETGSKELAKVDGNVTIKDLSFAF GEHKVLSGVSVDIKAGQTVAFVGKSGSGKTTLTSIISRFYTQHKGEILLDGVDTRELTLE NLRSHLSIVSQNVHLFDDTVYNNIAFGLSREVSEDEVIDALKRANAYEFVQELSDGIHTN IGNNGSKLSGGQRQRISIARALLKNAPVLIFDEATSALDNESERVVQQALESLTESCTTI VIAHRLSTVENADKIVVMDGGKVVESGKHQELLEQGGLYTGSINRDFNSTYAR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; valA; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q47908 |
◆ Recombinant Proteins | ||
UBP1-301617H | Recombinant Human UBP1 protein, GST-tagged | +Inquiry |
MYLPF-10325M | Recombinant Mouse MYLPF Protein | +Inquiry |
GUCY2D-1519H | Recombinant Human GUCY2D protein, His-Avi-tagged, Biotinylated | +Inquiry |
RFL6078SF | Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ybr124W (Ybr124W) Protein, His-Tagged | +Inquiry |
DLG3-1539R | Recombinant Rat DLG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
LDH5-225H | Active Native Human Lactate Dehydrogenase 5 | +Inquiry |
IgG-126R | Native Rat Immunoglobulin G | +Inquiry |
Lipoprotein-246 | Native Human Oxidized LDL (Ox-LDL) | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
DIS-2019 | Active Alpha-Cyclomaltodextrin glucanotransferase | +Inquiry |
◆ Cell & Tissue Lysates | ||
C17orf80-8228HCL | Recombinant Human C17orf80 293 Cell Lysate | +Inquiry |
Colon ascending-78C | Cynomolgus monkey Colon ascending Lysate | +Inquiry |
EPHA6-2502MCL | Recombinant Mouse EPHA6 Overexpression Lysate | +Inquiry |
ZACN-226HCL | Recombinant Human ZACN 293 Cell Lysate | +Inquiry |
ACVRL1-2629HCL | Recombinant Human ACVRL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket