Recombinant Full Length Pseudomonas Fluorescens Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL21052PF |
Product Overview : | Recombinant Full Length Pseudomonas fluorescens Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q3KJ31) (1-600aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas fluorescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-600) |
Form : | Lyophilized powder |
AA Sequence : | MTDSSPAASPSSLKIYFRLLGYVRPYISLFLISIVGFLIFASTQPMLGYILKYFVDGLSN PEAVLFPTVPYLRDLQLLQAVPLLIILIAAWQGLGSYLGNYFLAKVSLGLVHDLRVQLFN NLLVLPNRYFDKHNSGHLISRITFNVTMVTGAATDAIKVVIREGMTVIFLFASLLFMNWK LTLVMVAILPLIAVMVRTASKKFRKQSKKIQLAMGDVTHVASETIQGYRVVRSFGGEAYE EKRFLDASQGNTDKQLRMTRTGAIYTPLLQLVIYSAMAILMFLVLYLRGDASAGDMVAYI TLAGLLPKPIRQLSEVSSTIQKGVAGAESIFEQLDVEPEVDTGTVERDSVSGRLDVRNLS FTYPGTERQVLDDISFSVEPGQMVALVGRSGSGKSTLANLIPRFYHHDKGEILIDGVEVE QYKLLNLRRHIAQVTQHVTLFSDTVANNIAYGDLAGAPREDIEKAARDAYAMDFIAQLPE GLDTQVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDQVMK GRTTLVIAHRLSTIEKADLILVMDQGRIVERGTHDDLLAQNGYYARLNAMGLDAPAEDIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; Pfl01_0481; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q3KJ31 |
◆ Native Proteins | ||
ACTC1-166B | Active Native bovine ACTC1 | +Inquiry |
TRPM2-8463H | Native Human TRPM2 | +Inquiry |
FABP-177R | Native Rabbit Fatty acid Binding Protein | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
Fga-299M | Active Native Mouse Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSBG2-18HCL | Recombinant Human ACSBG2 cell lysate | +Inquiry |
ADAM8-855CCL | Recombinant Cynomolgus ADAM8 cell lysate | +Inquiry |
TYROBP-613HCL | Recombinant Human TYROBP 293 Cell Lysate | +Inquiry |
ERP44-6543HCL | Recombinant Human ERP44 293 Cell Lysate | +Inquiry |
CACNG2-7901HCL | Recombinant Human CACNG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket