Recombinant Full Length Pseudomonas Putida Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL23731PF |
Product Overview : | Recombinant Full Length Pseudomonas putida Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q88D92) (1-602aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas Putida |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-602) |
Form : | Lyophilized powder |
AA Sequence : | MAETPRPAEHTSSLKIYFRLLSYVKPYVGIFLLSIVGFVIFASTQPMLAGILKYFVDGLS NPEAVLFPNVPYLRDLQLLQAVPLLIILIAAWQGLGSFLGNYFLAKVSLSLVHDLRVALF NKLLVLPNRYFDNHNSGHLISRITFNVTMVTGAATDAIKVVIREGLTVVFLFAYLLWMNW HLTLVMVAILPVIAVMVSIASKKFRKQSKKIQVAMGDVTHVASETIQGYRVVRSFGGEAY EQQRFGQASQSNTDKQLRMTKTGSLYTPMLQLVIYSAMAALMFLVLFLRGDSTAGDLVAY ITAAGLLPKPIRQLSEVSSTIQKGLAGAESIFEQLDEAPEVDTGTVEKERVEGRLEVRNL SFTYPGTEREVLSDISFVAEPGQMIALVGRSGSGKSTLAALIPRFYHHDKGQILLDGVEI EHYRLRNLRRHVSQVTQHVTLFNDTVANNIAYGDLAGAPRADIEAAAADAYAKEFVDRLP KGFDTEVGENGVLLSGGQRQRLAIARALLKNAPLLILDEATSALDTESERHIQAALDHVM QGRTTLVIAHRLSTIEKADQILVMDQGRLVERGTHTELLAANGHYARLHAMGLDEPAKAD IT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; PP_4935; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q88D92 |
◆ Recombinant Proteins | ||
LYPD3-3412H | Recombinant Human LYPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
S100a13-5666M | Recombinant Mouse S100a13 Protein, Myc/DDK-tagged | +Inquiry |
LYN-3514R | Recombinant Rat LYN Protein | +Inquiry |
NAT3-5919M | Recombinant Mouse NAT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35679PF | Recombinant Full Length Pseudomonas Aeruginosa Cobalamin Synthase(Cobs) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Thermolysin | Native Geobacillus stearothermophilus Thermolysin Protein | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
CP-1767H | Native Human CP Protein | +Inquiry |
Ighg2b-162M | Native Mouse Immunoglobulin G2b | +Inquiry |
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRGAP3-631HCL | Recombinant Human SRGAP3 lysate | +Inquiry |
Raji-174H | Raji Whole Cell Lysate | +Inquiry |
H3F3A-5654HCL | Recombinant Human H3F3A 293 Cell Lysate | +Inquiry |
CCDC141-7777HCL | Recombinant Human CCDC141 293 Cell Lysate | +Inquiry |
CNTN5-1055MCL | Recombinant Mouse CNTN5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket