Recombinant Full Length Acinetobacter Sp. Lipid A Export Atp-Binding/Permease Protein Msba(Msba) Protein, His-Tagged
Cat.No. : | RFL23579AF |
Product Overview : | Recombinant Full Length Acinetobacter sp. Lipid A export ATP-binding/permease protein MsbA(msbA) Protein (Q6F9X0) (1-574aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Acinetobacter Baylyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-574) |
Form : | Lyophilized powder |
AA Sequence : | MKQDFKVYVRLLSYLKPYWGIALLVLVGFGINAATEVSVAKLLKYIIDAIQEGSRADLDW FPLLIVLLVFFRGLGLFMGGYYTAVISRRLIFSIRQEIYAKLIRLPSQYYLDNSSGHISA KIMYNVEQLTAASSESLKIMVKDGLITLGLLGYLLYTNWRLTLCIFIFMPIIGVLVRKAS KRMRKLSIQVQNTMGDVNHVVQESIGGQAVVKSFVGEEFEQKRFYKSSEDNLKRGLKMVI VQNLNSPLVQLVMAMAMSLIVWLALRPQILGETTAGEFVAYITAAGLLAKPIKNLTDVNE KLQRGIAAAYSVFELLDLPSEENHGTQTPKLQGDVRFDHVTLEYAGQVKAIKDFNLTIEP GETVAIVGRSGAGKTSLVNLLVRFQEVTSGSLYLDHIPIQDIELSCLRQQVAMVNQQVVL FNRSVRENIAYGQLEGAAEADIVAAAKAAYAHDFIMNLPQGYDTILGAQGLNLSGGQRQR IAIARAILKNAPILILDEATSALDNESEHFIQKAFDEAMQNRTTIVIAHRLSTIENADRI VVMDKGQIIEQGTHQELLLKQGAYFQLHQRNFEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | msbA |
Synonyms | msbA; ACIAD2365; ATP-dependent lipid A-core flippase; Lipid A export ATP-binding/permease protein MsbA |
UniProt ID | Q6F9X0 |
◆ Recombinant Proteins | ||
IL6R-3837H | Recombinant Human IL6R Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL5312HF | Recombinant Full Length Human Gap Junction Gamma-2 Protein(Gjc2) Protein, His-Tagged | +Inquiry |
CSNK1A1-1986H | Active Recombinant Human CSNK1A1 Protein, GST-His-tagged | +Inquiry |
Acsl4-5993M | Recombinant Mouse Acsl4 protein, His-tagged | +Inquiry |
MANSC1-136H | Recombinant Human MANSC1, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1733L | Active Native Lens Culinaris Agglutinin Protein, Rhodamine labeled | +Inquiry |
PRC1-5267P | Active Native Yeast PRC1 Protein | +Inquiry |
CFD-348H | Active Native Human Factor D | +Inquiry |
Collagen-55B | Native Bovine Collagen Type II | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC4D-1006RCL | Recombinant Rat CLEC4D cell lysate | +Inquiry |
NUP43-3630HCL | Recombinant Human NUP43 293 Cell Lysate | +Inquiry |
DMAP1-6901HCL | Recombinant Human DMAP1 293 Cell Lysate | +Inquiry |
SPRYD5-1686HCL | Recombinant Human SPRYD5 cell lysate | +Inquiry |
CPB-278R | Rabbit Anti-GST Polyclonal Antibody | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All msbA Products
Required fields are marked with *
My Review for All msbA Products
Required fields are marked with *
0
Inquiry Basket